1FT3 - JenaLib

Title :   CRYSTAL STRUCTURE OF TRUNCATED RHOGDI K141A MUTANT

Authors :   K. L. Longenecker, S. M. Garrard, P. J. Sheffield, Z. S. Derewenda

Date :   11 Sep 00 (Deposition) - 02 May 01 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.80

Chains :   Asym. Unit : A,B
Biol. Unit 1: A  (1x)
Biol. Unit 2: B  (1x)
Biol. Unit 3: A,B  (1x)
Biol. Unit 4: B  (2x)

Keywords :   Immunoglobulin Fold, Beta Sandwich Motif, Isoprenyl-Binding Domain, Gdp-Dissociation Inhibitor Of Rho Gtpases, Signaling Protein Inhibitor (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   K. L. Longenecker, S. M. Garrard, P. J. Sheffield, Z. S. Derewenda
Protein Crystallization By Rational Mutagenesis Of Surface Residues: Lys To Ala Mutations Promote Crystallization Of Rhogdi.
Acta Crystallogr. , Sect. D V. 57 679 2001
PubMed-ID: 11320308 | Reference-DOI: 10.1107/S0907444901003122
(for further references see the PDB file header)

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (4, 8)

Sequences/Alignments

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:129
 aligned with GDIR1_HUMAN | P52565 from UniProtKB/Swiss-Prot  Length:204

    Alignment length:138
                                    75        85        95       105       115       125       135       145       155       165       175       185       195        
          GDIR1_HUMAN    66 NVPNVVVTGLTLVCSSAPGPLELDLTGDLESFKKQSFVLKEGVEYRIKISFRVNREIVSGMKYIQHTYRKGVKIDKTDYMVGSYGPRAEEYEFLTPVEEAPKGMLARGSYSIKSRFTDDDKTDHLSWEWNLTIKKDWK 203
               SCOP domains d1ft3a_ A: Rho GDP-dissoci         ation inhibitor 1, RhoGDI                                                                               SCOP domains
               CATH domains 1ft3A00 A:66-203 Coagulati         on Factor XIII, subunit A, domain 1                                                                     CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ....eeeeeeeee........eee..---------.eeee...eeeeeeeeee....eeeeeeeeeeee..eeeeeeeeeeeee......eeee...ee........eeeeeeeeee.......eeeeeeeeee.... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
           Transcript 1 (1) Exon 1.3  PDB: A:66-91     -------------------------Exon 1.5              ---------------------------------------------------------------- Transcript 1 (1)
           Transcript 1 (2) --------------------------Exon 1.4  PDB: A:101-117  ---------------------Exon 1.6b  PDB: A:139-203 UniProt: 139-204 [INCOMPLETE]           Transcript 1 (2)
                 1ft3 A  66 MVPNVVVTGLTLVCSSAPGPLELDLT---------SFVLKEGVEYRIKISFRVNREIVSGMKYIQHTYRKGVKIDATDYMVGSYGPRAEEYEFLTPVEEAPKGMLARGSYSIKSRFTDDDKTDHLSWEWNLTIKKDWK 203
                                    75        85     |   -     | 105       115       125       135       145       155       165       175       185       195        
                                                    91       101

Chain B from PDB  Type:PROTEIN  Length:138
 aligned with GDIR1_HUMAN | P52565 from UniProtKB/Swiss-Prot  Length:204

    Alignment length:138
                                    75        85        95       105       115       125       135       145       155       165       175       185       195        
          GDIR1_HUMAN    66 NVPNVVVTGLTLVCSSAPGPLELDLTGDLESFKKQSFVLKEGVEYRIKISFRVNREIVSGMKYIQHTYRKGVKIDKTDYMVGSYGPRAEEYEFLTPVEEAPKGMLARGSYSIKSRFTDDDKTDHLSWEWNLTIKKDWK 203
               SCOP domains d1ft3b_ B: Rho GDP-dissociation inhibitor 1, RhoGDI                                                                                        SCOP domains
               CATH domains 1ft3B00 B:66-203 Coagulation Factor XIII, subunit A, domain 1                                                                              CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ....eeeeeeeee........eee....hhhhhhheeeee...eeeeeeeeee....eeeeeeeeeeee..eeeeeeeeeeeee......eeee...ee........eeeeeeeeee.......eeeeeeeeee.... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
           Transcript 1 (1) Exon 1.3  PDB: B:66-92     -------------------------Exon 1.5              ---------------------------------------------------------------- Transcript 1 (1)
           Transcript 1 (2) --------------------------Exon 1.4  PDB: B:92-117   ---------------------Exon 1.6b  PDB: B:139-203 UniProt: 139-204 [INCOMPLETE]           Transcript 1 (2)
                 1ft3 B  66 MVPNVVVTGLTLVCSSAPGPLELDLTGDLESFKKQSFVLKEGVEYRIKISFRVNREIVSGMKYIQHTYRKGVKIDATDYMVGSYGPRAEEYEFLTPVEEAPKGMLARGSYSIKSRFTDDDKTDHLSWEWNLTIKKDWK 203
                                    75        85        95       105       115       125       135       145       155       165       175       185       195

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (1, 2)

CATH Domains (1, 2)

Pfam Domains (0, 0)

Gene Ontology (18, 18)

Asymmetric Unit(hide GO term definitions)

Chain A,B (GDIR1_HUMAN | P52565)

molecular function
	GO:0005096	GTPase activator activity	Binds to and increases the activity of a GTPase, an enzyme that catalyzes the hydrolysis of GTP.
	GO:0005094	Rho GDP-dissociation inhibitor activity	Prevents the dissociation of GDP from the small GTPase Rho, thereby preventing GTP from binding.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
	GO:0006928	movement of cell or subcellular component	The directed, self-propelled movement of a cell or subcellular component without the involvement of an external agent such as a transporter or a pore.
	GO:0043066	negative regulation of apoptotic process	Any process that stops, prevents, or reduces the frequency, rate or extent of cell death by apoptotic process.
	GO:0050771	negative regulation of axonogenesis	Any process that stops, prevents, or reduces the frequency, rate or extent of axonogenesis.
	GO:0007162	negative regulation of cell adhesion	Any process that stops, prevents, or reduces the frequency, rate or extent of cell adhesion.
	GO:0043547	positive regulation of GTPase activity	Any process that activates or increases the activity of a GTPase.
	GO:0050772	positive regulation of axonogenesis	Any process that activates or increases the frequency, rate or extent of axonogenesis.
	GO:0035023	regulation of Rho protein signal transduction	Any process that modulates the frequency, rate or extent of Rho protein signal transduction.
	GO:2000249	regulation of actin cytoskeleton reorganization	Any process that modulates the frequency, rate or extent of actin cytoskeleton reorganization.
	GO:0050790	regulation of catalytic activity	Any process that modulates the activity of an enzyme.
	GO:0051056	regulation of small GTPase mediated signal transduction	Any process that modulates the frequency, rate or extent of small GTPase mediated signal transduction.
	GO:0071526	semaphorin-plexin signaling pathway	A series of molecular signals generated as a consequence of a semaphorin receptor (composed of a plexin and a neurophilin) binding to a semaphorin ligand.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005856	cytoskeleton	Any of the various filamentous elements that form the internal framework of cells, and typically remain after treatment of the cells with mild detergent to remove membrane constituents and soluble components of the cytoplasm. The term embraces intermediate filaments, microfilaments, microtubules, the microtrabecular lattice, and other structures characterized by a polymeric filamentous nature and long-range order within the cell. The various elements of the cytoskeleton not only serve in the maintenance of cellular shape but also have roles in other cellular functions, including cellular movement, cell division, endocytosis, and movement of organelles.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.

Visualization

Interactive Views

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1ft3)

	Sites
(no "Sites" information available for 1ft3)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1ft3)

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]
		Biological Unit 3	[ Jena3D ]
		Biological Unit 4	[ Jena3D ]

Still Images

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	1ft3
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	GDIR1_HUMAN \| P52565
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Description