Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - manually
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - manually
NMR Structure - manually  (Jmol Viewer)
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  STRUCTURE OF THE EGF DOMAIN OF P-SELECTIN, NMR, 19 STRUCTURES
 
Authors :  S. J. Freedman, D. G. Sanford, W. W. Bachovchin, B. C. Furie, J. D. Baleja, B. Furie
Date :  25 Mar 96  (Deposition) - 01 Apr 97  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (19x)
Keywords :  Egf-Like Domain, Cell Adhesion Protein, Transmembrane, Glycoprotein (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  S. J. Freedman, D. G. Sanford, W. W. Bachovchin, B. C. Furie, J. D. Baleja, B. Furie
Structure And Function Of The Epidermal Growth Factor Domain Of P-Selectin.
Biochemistry V. 35 13733 1996
PubMed-ID: 8901515  |  Reference-DOI: 10.1021/BI9610257
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - P-SELECTIN
    ChainsA
    EngineeredYES
    FragmentEGF DOMAIN, RESIDUES 119 - 158
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606

 Structural Features

(-) Chains, Units

  
NMR Structure (19x)

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1FSB)

(-) Sites  (0, 0)

(no "Site" information available for 1FSB)

(-) SS Bonds  (3, 3)

NMR Structure
No.Residues
1A:4 -A:15
2A:9 -A:24
3A:26 -A:35

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1FSB)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (1, 1)

NMR Structure (1, 1)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_019381G179RLYAM3_HUMANPolymorphism3917718AG20R

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (3, 2)

NMR Structure (3, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1EGF_1PS00022 EGF-like domain signature 1.LYAM3_HUMAN183-194  1A:24-35
2EGF_2PS01186 EGF-like domain signature 2.LYAM3_HUMAN183-194  1A:24-35
3SUSHIPS50923 Sushi/CCP/SCR domain profile.LYAM3_HUMAN198-259
260-321
322-383
384-445
446-507
508-569
570-631
640-701
702-763
  1A:39-40
-
-
-
-
-
-
-
-

(-) Exons   (3, 3)

NMR Structure (3, 3)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1bENST000002636861bENSE00001384287chr1:169599377-16959931068LYAM3_HUMAN1-110--
1.2bENST000002636862bENSE00001172331chr1:169588457-16958836791LYAM3_HUMAN2-32310--
1.3ENST000002636863ENSE00000814471chr1:169586652-169586266387LYAM3_HUMAN32-1611301A:1-22
1.4ENST000002636864ENSE00000814474chr1:169582931-169582824108LYAM3_HUMAN161-197371A:2-3837
1.5ENST000002636865ENSE00000789626chr1:169582352-169582167186LYAM3_HUMAN197-259631A:38-403
1.6ENST000002636866ENSE00000789625chr1:169581640-169581455186LYAM3_HUMAN259-321630--
1.7ENST000002636867ENSE00000814478chr1:169580915-169580730186LYAM3_HUMAN321-383630--
1.8ENST000002636868ENSE00000789623chr1:169578927-169578742186LYAM3_HUMAN383-445630--
1.9aENST000002636869aENSE00000814480chr1:169576372-169576187186LYAM3_HUMAN445-507630--
1.10ENST0000026368610ENSE00000814483chr1:169572449-169572264186LYAM3_HUMAN507-569630--
1.11ENST0000026368611ENSE00000814484chr1:169566414-169566229186LYAM3_HUMAN569-631630--
1.12ENST0000026368612ENSE00000450611chr1:169565372-169565163210LYAM3_HUMAN631-701710--
1.13ENST0000026368613ENSE00000958551chr1:169564115-169563930186LYAM3_HUMAN701-763630--
1.14ENST0000026368614ENSE00000450613chr1:169562962-169562843120LYAM3_HUMAN763-803410--
1.15bENST0000026368615bENSE00001168517chr1:169560694-16956066431LYAM3_HUMAN803-813110--
1.16bENST0000026368616bENSE00001168504chr1:169559440-16955938556LYAM3_HUMAN813-830180--
1.17hENST0000026368617hENSE00001359830chr1:169558699-169558090610LYAM3_HUMAN-00--

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:40
 aligned with LYAM3_HUMAN | P16109 from UniProtKB/Swiss-Prot  Length:830

    Alignment length:40
                                   169       179       189       199
          LYAM3_HUMAN   160 TASCQDMSCSKQGECLETIGNYTCSCYPGFYGPECEYVRE 199
               SCOP domains d1fsba_ A: P-selectin, EGF-domain        SCOP domains
               CATH domains 1fsbA00 A:1-40 Laminin                   CATH domains
               Pfam domains ---------------------------------------- Pfam domains
         Sec.struct. author ...........eeeeeee..eeeeeee.eeee...eeee. Sec.struct. author
                 SAPs(SNPs) -------------------R-------------------- SAPs(SNPs)
                PROSITE (1) -----------------------EGF_1       ---SU PROSITE (1)
                PROSITE (2) -----------------------EGF_2       ----- PROSITE (2)
           Transcript 1 (1) 1.-----------------------------------1.5 Transcript 1 (1)
           Transcript 1 (2) -Exon 1.4  PDB: A:2-38                -- Transcript 1 (2)
                 1fsb A   1 TASCQDMSCSKQGECLETIGNYTCSCYPGFYGPECEYVRE  40
                                    10        20        30        40

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

NMR Structure

(-) CATH Domains  (1, 1)

NMR Structure
(-)
Class: Mainly Beta (13760)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1FSB)

(-) Gene Ontology  (37, 37)

NMR Structure(hide GO term definitions)
Chain A   (LYAM3_HUMAN | P16109)
molecular function
    GO:0048306    calcium-dependent protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules), in the presence of calcium.
    GO:0030246    carbohydrate binding    Interacting selectively and non-covalently with any carbohydrate, which includes monosaccharides, oligosaccharides and polysaccharides as well as substances derived from monosaccharides by reduction of the carbonyl group (alditols), by oxidation of one or more hydroxy groups to afford the corresponding aldehydes, ketones, or carboxylic acids, or by replacement of one or more hydroxy group(s) by a hydrogen atom. Cyclitols are generally not regarded as carbohydrates.
    GO:0042806    fucose binding    Interacting selectively and non-covalently with fucose, the pentose 6-deoxygalactose.
    GO:0043208    glycosphingolipid binding    Interacting selectively and non-covalently with glycosphingolipid, a compound with residues of sphingoid and at least one monosaccharide.
    GO:0008201    heparin binding    Interacting selectively and non-covalently with heparin, any member of a group of glycosaminoglycans found mainly as an intracellular component of mast cells and which consist predominantly of alternating alpha-(1->4)-linked D-galactose and N-acetyl-D-glucosamine-6-sulfate residues.
    GO:0001530    lipopolysaccharide binding    Interacting selectively and non-covalently with lipopolysaccharide.
    GO:0070492    oligosaccharide binding    Interacting selectively and non-covalently with any oligosaccharide, a molecule with between two and (about) 20 monosaccharide residues connected by glycosidic linkages.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0033691    sialic acid binding    Interacting selectively and non-covalently with sialic acid, any of a variety of N- or O- substituted derivatives of neuraminic acid, a nine carbon monosaccharide. Sialic acids often occur in polysaccharides, glycoproteins, and glycolipids in animals and bacteria.
biological process
    GO:0035584    calcium-mediated signaling using intracellular calcium source    A series of molecular signals in which a cell uses calcium ions released from an intracellular store to convert a signal into a response.
    GO:0007155    cell adhesion    The attachment of a cell, either to another cell or to an underlying substrate such as the extracellular matrix, via cell adhesion molecules.
    GO:0050829    defense response to Gram-negative bacterium    Reactions triggered in response to the presence of a Gram-negative bacterium that act to protect the cell or organism.
    GO:0007157    heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules    The attachment of an adhesion molecule in one cell to a nonidentical adhesion molecule in an adjacent cell.
    GO:0006954    inflammatory response    The immediate defensive reaction (by vertebrate tissue) to infection or injury caused by chemical or physical agents. The process is characterized by local vasodilation, extravasation of plasma into intercellular spaces and accumulation of white blood cells and macrophages.
    GO:0007159    leukocyte cell-cell adhesion    The attachment of a leukocyte to another cell via adhesion molecules.
    GO:0050900    leukocyte migration    The movement of a leukocyte within or between different tissues and organs of the body.
    GO:0050901    leukocyte tethering or rolling    Transient adhesive interactions between leukocytes and endothelial cells lining blood vessels. Carbohydrates on circulating leukocytes bind selectins on the vessel wall causing the leukocytes to slow down and roll along the inner surface of the vessel wall. During this rolling motion, transitory bonds are formed and broken between selectins and their ligands. Typically the first step in cellular extravasation (the movement of leukocytes out of the circulatory system, towards the site of tissue damage or infection).
    GO:0002576    platelet degranulation    The regulated exocytosis of secretory granules containing preformed mediators such as histamine and serotonin by a platelet.
    GO:0045785    positive regulation of cell adhesion    Any process that activates or increases the frequency, rate or extent of cell adhesion.
    GO:0002687    positive regulation of leukocyte migration    Any process that activates or increases the frequency, rate, or extent of leukocyte migration.
    GO:0014068    positive regulation of phosphatidylinositol 3-kinase signaling    Any process that activates or increases the frequency, rate or extent of signal transduction mediated by the phosphatidylinositol 3-kinase cascade.
    GO:0010572    positive regulation of platelet activation    Any process that increases the rate or frequency of platelet activation. Platelet activation is a series of progressive, overlapping events triggered by exposure of the platelets to subendothelial tissue.
    GO:0002691    regulation of cellular extravasation    Any process that modulates the frequency, rate, or extent of cellular extravasation.
    GO:0033623    regulation of integrin activation    Any process that modulates the frequency, rate, or extent of integrin activation.
    GO:0032496    response to lipopolysaccharide    Any process that results in a change in state or activity of an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a lipopolysaccharide stimulus; lipopolysaccharide is a major component of the cell wall of gram-negative bacteria.
    GO:0014070    response to organic cyclic compound    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an organic cyclic compound stimulus.
    GO:0016337    single organismal cell-cell adhesion    The attachment of one cell to another cell via adhesion molecules, where both cells are part of the same organism.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0009897    external side of plasma membrane    The leaflet of the plasma membrane that faces away from the cytoplasm and any proteins embedded or anchored in it or attached to its surface.
    GO:0005615    extracellular space    That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0005887    integral component of plasma membrane    The component of the plasma membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0005654    nucleoplasm    That part of the nuclear content other than the chromosomes or the nucleolus.
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
    GO:0031092    platelet alpha granule membrane    The lipid bilayer surrounding the platelet alpha granule.
    GO:0031088    platelet dense granule membrane    The lipid bilayer surrounding the platelet dense granule.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1fsb)
 
  Sites
(no "Sites" information available for 1fsb)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1fsb)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1fsb
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  LYAM3_HUMAN | P16109
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  LYAM3_HUMAN | P16109
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        LYAM3_HUMAN | P161091g1q 1g1r 1g1s 1hes 1kjd

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1FSB)