1FPZ - JenaLib

Biol.Unit 1 - manually (Jmol Viewer)

Asymmetric Unit (Jmol Viewer)

Asym. Unit - sites (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biol. Unit 1 - sites (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Biological Unit 3 (Jmol Viewer)

Biological Unit 4 (Jmol Viewer)

Biological Unit 5 (Jmol Viewer)

Biological Unit 6 (Jmol Viewer)

Title :   CRYSTAL STRUCTURE ANALYSIS OF KINASE ASSOCIATED PHOSPHATASE (KAP) WITH A SUBSTITUTION OF THE CATALYTIC SITE CYSTEINE (CYS140) TO A SERINE

Authors :   H. Song, N. Hanlon, N. R. Brown, M. E. M. Noble, L. N. Johnson, D. Barford

Date :   01 Sep 00 (Deposition) - 09 May 01 (Release) - 14 Apr 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.00

Chains :   Asym. Unit : A,B,C,D,E,F
Biol. Unit 1: A  (1x)
Biol. Unit 2: B  (1x)
Biol. Unit 3: C  (1x)
Biol. Unit 4: D  (1x)
Biol. Unit 5: E  (1x)
Biol. Unit 6: F  (1x)

Keywords :   Alpha-Beta Sandwich, Hydrolase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   H. Song, N. Hanlon, N. R. Brown, M. E. Noble, L. N. Johnson, D. Barford
Phosphoprotein-Protein Interactions Revealed By The Crystal Structure Of Kinase-Associated Phosphatase In Complex With Phosphocdk2.
Mol. Cell V. 7 615 2001
PubMed-ID: 11463386 | Reference-DOI: 10.1016/S1097-2765(01)00208-8
(for further references see the PDB file header)

Molecule 1 - CYCLIN-DEPENDENT KINASE INHIBITOR 3
	Chains	:	A, B, C, D, E, F
	EC Number	:	3.1.3.48
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Taxid	:	562
	Expression System Vector	:	PGEX-6P
	Mutation	:	YES
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Other Details	:	HOMO SAPIENS

		1	2	3	4	5	6
Asymmetric Unit	:	A	B	C	D	E	F
Biological Unit 1 (1x)	:	A
Biological Unit 2 (1x)	:		B
Biological Unit 3 (1x)	:			C
Biological Unit 4 (1x)	:				D
Biological Unit 5 (1x)	:					E
Biological Unit 6 (1x)	:						F

Summary Information (see also Sequences/Alignments below)

Asymmetric Unit (1, 6)

No.	Name	Count	Type	Full Name
1	SO4	6	Ligand/Ion	SULFATE ION

Biological Unit 1 (1, 1)

No.	Name	Count	Type	Full Name
1	SO4	1	Ligand/Ion	SULFATE ION

Biological Unit 2 (1, 1)

No.	Name	Count	Type	Full Name
1	SO4	1	Ligand/Ion	SULFATE ION

Biological Unit 3 (1, 1)

No.	Name	Count	Type	Full Name
1	SO4	1	Ligand/Ion	SULFATE ION

Biological Unit 4 (1, 1)

No.	Name	Count	Type	Full Name
1	SO4	1	Ligand/Ion	SULFATE ION

Biological Unit 5 (1, 1)

No.	Name	Count	Type	Full Name
1	SO4	1	Ligand/Ion	SULFATE ION

Biological Unit 6 (1, 1)

No.	Name	Count	Type	Full Name
1	SO4	1	Ligand/Ion	SULFATE ION

Asymmetric Unit (6, 6)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	GLY A:142 , LEU A:144 , GLY A:145 , ARG A:146 , GLN A:181	BINDING SITE FOR RESIDUE SO4 A 900
2	AC2	SOFTWARE	SER B:140 , TYR B:141 , GLY B:142 , GLY B:143 , LEU B:144 , GLY B:145 , ARG B:146 , GLN B:181 , HOH B:947	BINDING SITE FOR RESIDUE SO4 B 901
3	AC3	SOFTWARE	SER C:140 , TYR C:141 , GLY C:142 , GLY C:143 , LEU C:144 , GLY C:145 , ARG C:146 , HOH C:912 , HOH C:923 , HOH C:968	BINDING SITE FOR RESIDUE SO4 C 902
4	AC4	SOFTWARE	SER D:140 , TYR D:141 , GLY D:142 , GLY D:143 , LEU D:144 , GLY D:145 , ARG D:146	BINDING SITE FOR RESIDUE SO4 D 903
5	AC5	SOFTWARE	ASP E:110 , SER E:140 , TYR E:141 , GLY E:142 , GLY E:143 , LEU E:144 , GLY E:145 , ARG E:146 , HOH E:906 , HOH E:1026	BINDING SITE FOR RESIDUE SO4 E 904
6	AC6	SOFTWARE	SER F:140 , TYR F:141 , GLY F:142 , GLY F:143 , LEU F:144 , GLY F:145 , ARG F:146	BINDING SITE FOR RESIDUE SO4 F 905

(no "SS Bond" information available for 1FPZ)

(no "Cis Peptide Bond" information available for 1FPZ)

Asymmetric Unit (10, 60)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_013842	W	31	R	CDKN3_HUMAN	Disease (HCC)	---	A/B/C/D/E/F	W	31	R
02	UniProt	VAR_013843	F	78	L	CDKN3_HUMAN	Disease (HCC)	---	A/B/C/D/E/F	F	78	L
03	UniProt	VAR_013844	C	79	Y	CDKN3_HUMAN	Disease (HCC)	---	A/B/C/D/E/F	C	79	Y
04	UniProt	VAR_013845	N	91	K	CDKN3_HUMAN	Disease (HCC)	760687800	A/B/C/D/E/F	N	91	K
05	UniProt	VAR_013846	D	94	V	CDKN3_HUMAN	Disease (HCC)	---	A/B/C/D/E/F	D	94	V
06	UniProt	VAR_013847	L	95	F	CDKN3_HUMAN	Disease (HCC)	---	A/B/C/D/E/F	L	95	F
07	UniProt	VAR_013848	I	108	V	CDKN3_HUMAN	Disease (HCC)	144479038	A/B/C/D/E/F	I	108	V
08	UniProt	VAR_051769	S	159	F	CDKN3_HUMAN	Polymorphism	1803843	A/B/C/D/E/F	S	159	F
09	UniProt	VAR_013849	N	187	S	CDKN3_HUMAN	Disease (HCC)	---	A/B/C/D/E/F	N	187	S
10	UniProt	VAR_013850	K	195	I	CDKN3_HUMAN	Disease (HCC)	---	A/B/C/D/E/F	K	195	I

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 1 (10, 10)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_013842	W	31	R	CDKN3_HUMAN	Disease (HCC)	---	A	W	31	R
02	UniProt	VAR_013843	F	78	L	CDKN3_HUMAN	Disease (HCC)	---	A	F	78	L
03	UniProt	VAR_013844	C	79	Y	CDKN3_HUMAN	Disease (HCC)	---	A	C	79	Y
04	UniProt	VAR_013845	N	91	K	CDKN3_HUMAN	Disease (HCC)	760687800	A	N	91	K
05	UniProt	VAR_013846	D	94	V	CDKN3_HUMAN	Disease (HCC)	---	A	D	94	V
06	UniProt	VAR_013847	L	95	F	CDKN3_HUMAN	Disease (HCC)	---	A	L	95	F
07	UniProt	VAR_013848	I	108	V	CDKN3_HUMAN	Disease (HCC)	144479038	A	I	108	V
08	UniProt	VAR_051769	S	159	F	CDKN3_HUMAN	Polymorphism	1803843	A	S	159	F
09	UniProt	VAR_013849	N	187	S	CDKN3_HUMAN	Disease (HCC)	---	A	N	187	S
10	UniProt	VAR_013850	K	195	I	CDKN3_HUMAN	Disease (HCC)	---	A	K	195	I

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 2 (10, 10)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_013842	W	31	R	CDKN3_HUMAN	Disease (HCC)	---	B	W	31	R
02	UniProt	VAR_013843	F	78	L	CDKN3_HUMAN	Disease (HCC)	---	B	F	78	L
03	UniProt	VAR_013844	C	79	Y	CDKN3_HUMAN	Disease (HCC)	---	B	C	79	Y
04	UniProt	VAR_013845	N	91	K	CDKN3_HUMAN	Disease (HCC)	760687800	B	N	91	K
05	UniProt	VAR_013846	D	94	V	CDKN3_HUMAN	Disease (HCC)	---	B	D	94	V
06	UniProt	VAR_013847	L	95	F	CDKN3_HUMAN	Disease (HCC)	---	B	L	95	F
07	UniProt	VAR_013848	I	108	V	CDKN3_HUMAN	Disease (HCC)	144479038	B	I	108	V
08	UniProt	VAR_051769	S	159	F	CDKN3_HUMAN	Polymorphism	1803843	B	S	159	F
09	UniProt	VAR_013849	N	187	S	CDKN3_HUMAN	Disease (HCC)	---	B	N	187	S
10	UniProt	VAR_013850	K	195	I	CDKN3_HUMAN	Disease (HCC)	---	B	K	195	I

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 3 (10, 10)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_013842	W	31	R	CDKN3_HUMAN	Disease (HCC)	---	C	W	31	R
02	UniProt	VAR_013843	F	78	L	CDKN3_HUMAN	Disease (HCC)	---	C	F	78	L
03	UniProt	VAR_013844	C	79	Y	CDKN3_HUMAN	Disease (HCC)	---	C	C	79	Y
04	UniProt	VAR_013845	N	91	K	CDKN3_HUMAN	Disease (HCC)	760687800	C	N	91	K
05	UniProt	VAR_013846	D	94	V	CDKN3_HUMAN	Disease (HCC)	---	C	D	94	V
06	UniProt	VAR_013847	L	95	F	CDKN3_HUMAN	Disease (HCC)	---	C	L	95	F
07	UniProt	VAR_013848	I	108	V	CDKN3_HUMAN	Disease (HCC)	144479038	C	I	108	V
08	UniProt	VAR_051769	S	159	F	CDKN3_HUMAN	Polymorphism	1803843	C	S	159	F
09	UniProt	VAR_013849	N	187	S	CDKN3_HUMAN	Disease (HCC)	---	C	N	187	S
10	UniProt	VAR_013850	K	195	I	CDKN3_HUMAN	Disease (HCC)	---	C	K	195	I

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 4 (10, 10)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_013842	W	31	R	CDKN3_HUMAN	Disease (HCC)	---	D	W	31	R
02	UniProt	VAR_013843	F	78	L	CDKN3_HUMAN	Disease (HCC)	---	D	F	78	L
03	UniProt	VAR_013844	C	79	Y	CDKN3_HUMAN	Disease (HCC)	---	D	C	79	Y
04	UniProt	VAR_013845	N	91	K	CDKN3_HUMAN	Disease (HCC)	760687800	D	N	91	K
05	UniProt	VAR_013846	D	94	V	CDKN3_HUMAN	Disease (HCC)	---	D	D	94	V
06	UniProt	VAR_013847	L	95	F	CDKN3_HUMAN	Disease (HCC)	---	D	L	95	F
07	UniProt	VAR_013848	I	108	V	CDKN3_HUMAN	Disease (HCC)	144479038	D	I	108	V
08	UniProt	VAR_051769	S	159	F	CDKN3_HUMAN	Polymorphism	1803843	D	S	159	F
09	UniProt	VAR_013849	N	187	S	CDKN3_HUMAN	Disease (HCC)	---	D	N	187	S
10	UniProt	VAR_013850	K	195	I	CDKN3_HUMAN	Disease (HCC)	---	D	K	195	I

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 5 (10, 10)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_013842	W	31	R	CDKN3_HUMAN	Disease (HCC)	---	E	W	31	R
02	UniProt	VAR_013843	F	78	L	CDKN3_HUMAN	Disease (HCC)	---	E	F	78	L
03	UniProt	VAR_013844	C	79	Y	CDKN3_HUMAN	Disease (HCC)	---	E	C	79	Y
04	UniProt	VAR_013845	N	91	K	CDKN3_HUMAN	Disease (HCC)	760687800	E	N	91	K
05	UniProt	VAR_013846	D	94	V	CDKN3_HUMAN	Disease (HCC)	---	E	D	94	V
06	UniProt	VAR_013847	L	95	F	CDKN3_HUMAN	Disease (HCC)	---	E	L	95	F
07	UniProt	VAR_013848	I	108	V	CDKN3_HUMAN	Disease (HCC)	144479038	E	I	108	V
08	UniProt	VAR_051769	S	159	F	CDKN3_HUMAN	Polymorphism	1803843	E	S	159	F
09	UniProt	VAR_013849	N	187	S	CDKN3_HUMAN	Disease (HCC)	---	E	N	187	S
10	UniProt	VAR_013850	K	195	I	CDKN3_HUMAN	Disease (HCC)	---	E	K	195	I

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 6 (10, 10)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_013842	W	31	R	CDKN3_HUMAN	Disease (HCC)	---	F	W	31	R
02	UniProt	VAR_013843	F	78	L	CDKN3_HUMAN	Disease (HCC)	---	F	F	78	L
03	UniProt	VAR_013844	C	79	Y	CDKN3_HUMAN	Disease (HCC)	---	F	C	79	Y
04	UniProt	VAR_013845	N	91	K	CDKN3_HUMAN	Disease (HCC)	760687800	F	N	91	K
05	UniProt	VAR_013846	D	94	V	CDKN3_HUMAN	Disease (HCC)	---	F	D	94	V
06	UniProt	VAR_013847	L	95	F	CDKN3_HUMAN	Disease (HCC)	---	F	L	95	F
07	UniProt	VAR_013848	I	108	V	CDKN3_HUMAN	Disease (HCC)	144479038	F	I	108	V
08	UniProt	VAR_051769	S	159	F	CDKN3_HUMAN	Polymorphism	1803843	F	S	159	F
09	UniProt	VAR_013849	N	187	S	CDKN3_HUMAN	Disease (HCC)	---	F	N	187	S
10	UniProt	VAR_013850	K	195	I	CDKN3_HUMAN	Disease (HCC)	---	F	K	195	I

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Asymmetric Unit (1, 6)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	TYR_PHOSPHATASE_2	PS50056	Tyrosine specific protein phosphatases family profile.	CDKN3_HUMAN	135-187	6	A:135-187 B:135-187 C:135-187 D:135-187 E:135-187 F:135-187

Biological Unit 1 (1, 1)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	TYR_PHOSPHATASE_2	PS50056	Tyrosine specific protein phosphatases family profile.	CDKN3_HUMAN	135-187	1	A:135-187 - - - - -

Biological Unit 2 (1, 1)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	TYR_PHOSPHATASE_2	PS50056	Tyrosine specific protein phosphatases family profile.	CDKN3_HUMAN	135-187	1	- B:135-187 - - - -

Biological Unit 3 (1, 1)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	TYR_PHOSPHATASE_2	PS50056	Tyrosine specific protein phosphatases family profile.	CDKN3_HUMAN	135-187	1	- - C:135-187 - - -

Biological Unit 4 (1, 1)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	TYR_PHOSPHATASE_2	PS50056	Tyrosine specific protein phosphatases family profile.	CDKN3_HUMAN	135-187	1	- - - D:135-187 - -

Biological Unit 5 (1, 1)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	TYR_PHOSPHATASE_2	PS50056	Tyrosine specific protein phosphatases family profile.	CDKN3_HUMAN	135-187	1	- - - - E:135-187 -

Biological Unit 6 (1, 1)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	TYR_PHOSPHATASE_2	PS50056	Tyrosine specific protein phosphatases family profile.	CDKN3_HUMAN	135-187	1	- - - - - F:135-187

Asymmetric Unit (7, 42)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1	ENST00000335183	1	ENSE00001418528	chr14:54863673-54863795	123	CDKN3_HUMAN	1-3	3	0	-	-
1.2c	ENST00000335183	2c	ENSE00001233458	chr14:54866612-54866694	83	CDKN3_HUMAN	4-31	28	6	A:25-31 B:25-31 C:23-31 D:23-31 E:25-31 F:23-31	7 7 9 9 7 9
1.3a	ENST00000335183	3a	ENSE00000657539	chr14:54868242-54868297	56	CDKN3_HUMAN	31-50	20	6	A:31-50 B:31-50 C:31-50 D:31-50 E:31-50 F:31-50	20 20 20 20 20 20
1.5	ENST00000335183	5	ENSE00001415342	chr14:54875463-54875507	45	CDKN3_HUMAN	50-65	16	6	A:50-65 B:50-65 C:50-65 D:50-65 E:50-65 F:50-65	16 16 16 16 16 16
1.6	ENST00000335183	6	ENSE00000854777	chr14:54878202-54878424	223	CDKN3_HUMAN	65-139	75	6	A:65-139 B:65-139 C:65-139 D:65-139 E:65-139 F:65-139	75 75 75 75 75 75
1.8	ENST00000335183	8	ENSE00001002759	chr14:54882617-54882648	32	CDKN3_HUMAN	139-150	12	6	A:139-150 B:139-150 C:139-150 D:139-150 E:139-150 F:139-150	12 12 12 12 12 12
1.9	ENST00000335183	9	ENSE00000854778	chr14:54884566-54884669	104	CDKN3_HUMAN	150-184	35	6	A:150-184 B:150-184 C:150-184 D:150-184 E:150-184 F:150-184	35 35 35 35 35 35
1.10c	ENST00000335183	10c	ENSE00001917135	chr14:54886710-54886936	227	CDKN3_HUMAN	185-212	28	6	A:185-200 B:185-200 C:185-200 D:185-200 E:185-200 F:185-200	16 16 16 16 16 16

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:176
 aligned with CDKN3_HUMAN | Q16667 from UniProtKB/Swiss-Prot  Length:212

    Alignment length:176
                                    34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194      
          CDKN3_HUMAN    25 TPIHISWLSLSRVNCSQFLGLCALPGCKFKDVRRNVQKDTEELKSCGIQDIFVFCTRGELSKYRVPNLLDLYQQCGIITHHHPIADGGTPDIASCCEIMEELTTCLKNYRKTLIHCYGGLGRSCLVAACLLLYLSDTISPEQAIDSLRDLRGSGAIQTIKQYNYLHEFRDKLAAHL 200
               SCOP domains d1fpza_ A: Kinase associated phosphatase (kap)                                                                                                                                   SCOP domains
               CATH domains 1fpzA00 A:25-200 Protein tyrosine phosphatase superfamily                                                                                                                        CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....eeee.hhhh...eeeee.....ee..ee.hhhhhhhhhhhhh..eeee..hhhhhhhh...hhhhhhhhh..eeee.........hhhhhhhhhhhhhhhhhh...eeee.....hhhhhhhhhhhhhhh...hhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ------R----------------------------------------------LY-----------K--VF------------V--------------------------------------------------F---------------------------S-------I----- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------TYR_PHOSPHATASE_2  PDB: A:135-187 UniProt: 135-187   ------------- PROSITE
           Transcript 1 (1) 1.2c   ------------------Exon 1.5        -------------------------------------------------------------------------Exon 1.8    ----------------------------------Exon 1.10c       Transcript 1 (1)
           Transcript 1 (2) ------Exon 1.3a           --------------Exon 1.6  PDB: A:65-139 UniProt: 65-139                                    ----------Exon 1.9  PDB: A:150-184           ---------------- Transcript 1 (2)
                 1fpz A  25 TPIHISWLSLSRVNCSQFLGLCALPGCKFKDVRRNVQKDTEELKSCGIQDIFVFCTRGELSKYRVPNLLDLYQQCGIITHHHPIADGGTPDIASCCEIMEELTTCLKNYRKTLIHSYGGLGRSCLVAACLLLYLSDTISPEQAIDSLRDLRGSGAIQTIKQYNYLHEFRDKLAAHL 200
                                    34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194

Chain B from PDB  Type:PROTEIN  Length:176
 aligned with CDKN3_HUMAN | Q16667 from UniProtKB/Swiss-Prot  Length:212

    Alignment length:176
                                    34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194      
          CDKN3_HUMAN    25 TPIHISWLSLSRVNCSQFLGLCALPGCKFKDVRRNVQKDTEELKSCGIQDIFVFCTRGELSKYRVPNLLDLYQQCGIITHHHPIADGGTPDIASCCEIMEELTTCLKNYRKTLIHCYGGLGRSCLVAACLLLYLSDTISPEQAIDSLRDLRGSGAIQTIKQYNYLHEFRDKLAAHL 200
               SCOP domains d1fpzb_ B: Kinase associated phosphatase (kap)                                                                                                                                   SCOP domains
               CATH domains 1fpzB00 B:25-200 Protein tyrosine phosphatase superfamily                                                                                                                        CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....eeee.hhhh...eeeee.....ee..ee.hhhhhhhhhhhh...eeee..hhhhhhhh...hhhhhhhhh..eeee.........hhhhhhhhhhhhhhhhhh...eeee.....hhhhhhhhhhhhhhh...hhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ------R----------------------------------------------LY-----------K--VF------------V--------------------------------------------------F---------------------------S-------I----- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------TYR_PHOSPHATASE_2  PDB: B:135-187 UniProt: 135-187   ------------- PROSITE
           Transcript 1 (1) 1.2c   ------------------Exon 1.5        -------------------------------------------------------------------------Exon 1.8    ----------------------------------Exon 1.10c       Transcript 1 (1)
           Transcript 1 (2) ------Exon 1.3a           --------------Exon 1.6  PDB: B:65-139 UniProt: 65-139                                    ----------Exon 1.9  PDB: B:150-184           ---------------- Transcript 1 (2)
                 1fpz B  25 TPIHISWLSLSRVNCSQFLGLCALPGCKFKDVRRNVQKDTEELKSCGIQDIFVFCTRGELSKYRVPNLLDLYQQCGIITHHHPIADGGTPDIASCCEIMEELTTCLKNYRKTLIHSYGGLGRSCLVAACLLLYLSDTISPEQAIDSLRDLRGSGAIQTIKQYNYLHEFRDKLAAHL 200
                                    34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194

Chain C from PDB  Type:PROTEIN  Length:178
 aligned with CDKN3_HUMAN | Q16667 from UniProtKB/Swiss-Prot  Length:212

    Alignment length:178
                                    32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192        
          CDKN3_HUMAN    23 EQTPIHISWLSLSRVNCSQFLGLCALPGCKFKDVRRNVQKDTEELKSCGIQDIFVFCTRGELSKYRVPNLLDLYQQCGIITHHHPIADGGTPDIASCCEIMEELTTCLKNYRKTLIHCYGGLGRSCLVAACLLLYLSDTISPEQAIDSLRDLRGSGAIQTIKQYNYLHEFRDKLAAHL 200
               SCOP domains d1fpzc_ C: Kinase associated phosphatase (kap)                                                                                                                                     SCOP domains
               CATH domains 1fpzC00 C:23-200 Protein tyrosine phosphatase superfamily                                                                                                                          CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .......eeee.hhhh...eeeee.....ee..ee.hhhhhhhhhhhh...eeee..hhhhhhhh...hhhhhhhhh..eeee.........hhhhhhhhhhhhhhhhhh...eeee.....hhhhhhhhhhhhhhh...hhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) --------R----------------------------------------------LY-----------K--VF------------V--------------------------------------------------F---------------------------S-------I----- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------TYR_PHOSPHATASE_2  PDB: C:135-187 UniProt: 135-187   ------------- PROSITE
           Transcript 1 (1) Exon 1.2c------------------Exon 1.5        -------------------------------------------------------------------------Exon 1.8    ----------------------------------Exon 1.10c       Transcript 1 (1)
           Transcript 1 (2) --------Exon 1.3a           --------------Exon 1.6  PDB: C:65-139 UniProt: 65-139                                    ----------Exon 1.9  PDB: C:150-184           ---------------- Transcript 1 (2)
                 1fpz C  23 EQTPIHISWLSLSRVNCSQFLGLCALPGCKFKDVRRNVQKDTEELKSCGIQDIFVFCTRGELSKYRVPNLLDLYQQCGIITHHHPIADGGTPDIASCCEIMEELTTCLKNYRKTLIHSYGGLGRSCLVAACLLLYLSDTISPEQAIDSLRDLRGSGAIQTIKQYNYLHEFRDKLAAHL 200
                                    32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192

Chain D from PDB  Type:PROTEIN  Length:178
 aligned with CDKN3_HUMAN | Q16667 from UniProtKB/Swiss-Prot  Length:212

    Alignment length:178
                                    32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192        
          CDKN3_HUMAN    23 EQTPIHISWLSLSRVNCSQFLGLCALPGCKFKDVRRNVQKDTEELKSCGIQDIFVFCTRGELSKYRVPNLLDLYQQCGIITHHHPIADGGTPDIASCCEIMEELTTCLKNYRKTLIHCYGGLGRSCLVAACLLLYLSDTISPEQAIDSLRDLRGSGAIQTIKQYNYLHEFRDKLAAHL 200
               SCOP domains d1fpzd_ D: Kinase associated phosphatase (kap)                                                                                                                                     SCOP domains
               CATH domains 1fpzD00 D:23-200 Protein tyrosine phosphatase superfamily                                                                                                                          CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .......eeee.hhhh...eeee......ee..ee.hhhhhhhhhhhh...eeee..hhhhhhhh...hhhhhhhhh..eeee.........hhhhhhhhhhhhhhhhhh...eeee.....hhhhhhhhhhhhhhh...hhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) --------R----------------------------------------------LY-----------K--VF------------V--------------------------------------------------F---------------------------S-------I----- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------TYR_PHOSPHATASE_2  PDB: D:135-187 UniProt: 135-187   ------------- PROSITE
           Transcript 1 (1) Exon 1.2c------------------Exon 1.5        -------------------------------------------------------------------------Exon 1.8    ----------------------------------Exon 1.10c       Transcript 1 (1)
           Transcript 1 (2) --------Exon 1.3a           --------------Exon 1.6  PDB: D:65-139 UniProt: 65-139                                    ----------Exon 1.9  PDB: D:150-184           ---------------- Transcript 1 (2)
                 1fpz D  23 EQTPIHISWLSLSRVNCSQFLGLCALPGCKFKDVRRNVQKDTEELKSCGIQDIFVFCTRGELSKYRVPNLLDLYQQCGIITHHHPIADGGTPDIASCCEIMEELTTCLKNYRKTLIHSYGGLGRSCLVAACLLLYLSDTISPEQAIDSLRDLRGSGAIQTIKQYNYLHEFRDKLAAHL 200
                                    32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192

Chain E from PDB  Type:PROTEIN  Length:176
 aligned with CDKN3_HUMAN | Q16667 from UniProtKB/Swiss-Prot  Length:212

    Alignment length:176
                                    34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194      
          CDKN3_HUMAN    25 TPIHISWLSLSRVNCSQFLGLCALPGCKFKDVRRNVQKDTEELKSCGIQDIFVFCTRGELSKYRVPNLLDLYQQCGIITHHHPIADGGTPDIASCCEIMEELTTCLKNYRKTLIHCYGGLGRSCLVAACLLLYLSDTISPEQAIDSLRDLRGSGAIQTIKQYNYLHEFRDKLAAHL 200
               SCOP domains d1fpze_ E: Kinase associated phosphatase (kap)                                                                                                                                   SCOP domains
               CATH domains 1fpzE00 E:25-200 Protein tyrosine phosphatase superfamily                                                                                                                        CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....eeee.hhhh...eeeee.....ee..ee.hhhhhhhhhhhh...eeee..hhhhhhhh...hhhhhhhhh..eeee.........hhhhhhhhhhhhhhhhhh...eeee.....hhhhhhhhhhhhhhh...hhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ------R----------------------------------------------LY-----------K--VF------------V--------------------------------------------------F---------------------------S-------I----- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------TYR_PHOSPHATASE_2  PDB: E:135-187 UniProt: 135-187   ------------- PROSITE
           Transcript 1 (1) 1.2c   ------------------Exon 1.5        -------------------------------------------------------------------------Exon 1.8    ----------------------------------Exon 1.10c       Transcript 1 (1)
           Transcript 1 (2) ------Exon 1.3a           --------------Exon 1.6  PDB: E:65-139 UniProt: 65-139                                    ----------Exon 1.9  PDB: E:150-184           ---------------- Transcript 1 (2)
                 1fpz E  25 TPIHISWLSLSRVNCSQFLGLCALPGCKFKDVRRNVQKDTEELKSCGIQDIFVFCTRGELSKYRVPNLLDLYQQCGIITHHHPIADGGTPDIASCCEIMEELTTCLKNYRKTLIHSYGGLGRSCLVAACLLLYLSDTISPEQAIDSLRDLRGSGAIQTIKQYNYLHEFRDKLAAHL 200
                                    34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194

Chain F from PDB  Type:PROTEIN  Length:178
 aligned with CDKN3_HUMAN | Q16667 from UniProtKB/Swiss-Prot  Length:212

    Alignment length:178
                                    32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192        
          CDKN3_HUMAN    23 EQTPIHISWLSLSRVNCSQFLGLCALPGCKFKDVRRNVQKDTEELKSCGIQDIFVFCTRGELSKYRVPNLLDLYQQCGIITHHHPIADGGTPDIASCCEIMEELTTCLKNYRKTLIHCYGGLGRSCLVAACLLLYLSDTISPEQAIDSLRDLRGSGAIQTIKQYNYLHEFRDKLAAHL 200
               SCOP domains d1fpzf_ F: Kinase associated phosphatase (kap)                                                                                                                                     SCOP domains
               CATH domains 1fpzF00 F:23-200 Protein tyrosine phosphatase superfamily                                                                                                                          CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .......eeee.hhhh...eeeee.....ee..ee.hhhhhhhhhhhh...eeee..hhhhhhhh...hhhhhhhhh..eeee.........hhhhhhhhhhhhhhhhhh...eeee.....hhhhhhhhhhhhhhh...hhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) --------R----------------------------------------------LY-----------K--VF------------V--------------------------------------------------F---------------------------S-------I----- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------TYR_PHOSPHATASE_2  PDB: F:135-187 UniProt: 135-187   ------------- PROSITE
           Transcript 1 (1) Exon 1.2c------------------Exon 1.5        -------------------------------------------------------------------------Exon 1.8    ----------------------------------Exon 1.10c       Transcript 1 (1)
           Transcript 1 (2) --------Exon 1.3a           --------------Exon 1.6  PDB: F:65-139 UniProt: 65-139                                    ----------Exon 1.9  PDB: F:150-184           ---------------- Transcript 1 (2)
                 1fpz F  23 EQTPIHISWLSLSRVNCSQFLGLCALPGCKFKDVRRNVQKDTEELKSCGIQDIFVFCTRGELSKYRVPNLLDLYQQCGIITHHHPIADGGTPDIASCCEIMEELTTCLKNYRKTLIHSYGGLGRSCLVAACLLLYLSDTISPEQAIDSLRDLRGSGAIQTIKQYNYLHEFRDKLAAHL 200
                                    32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: Alpha and beta proteins (a/b) (23833)

Fold: (Phosphotyrosine protein) phosphatases II (296)

Superfamily: (Phosphotyrosine protein) phosphatases II (296)

Family: Dual specificity phosphatase-like (27)

Protein domain: Kinase associated phosphatase (kap) (2)

Human (Homo sapiens) [TaxId: 9606] (2)

1a	d1fpza_	A:
1b	d1fpzb_	B:
1c	d1fpzc_	C:
1d	d1fpzd_	D:
1e	d1fpze_	E:
1f	d1fpzf_	F:

Asymmetric Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Alpha Beta (26913)

Architecture: Alpha-Beta Complex (3881)

Topology: Protein-Tyrosine Phosphatase; Chain A (262)

Homologous Superfamily: Protein tyrosine phosphatase superfamily (228)

Human (Homo sapiens) (196)

1a	1fpzC00	C:23-200
1b	1fpzD00	D:23-200
1c	1fpzF00	F:23-200
1d	1fpzA00	A:25-200
1e	1fpzB00	B:25-200
1f	1fpzE00	E:25-200

(no "Pfam Domain" information available for 1FPZ)

Asymmetric Unit(hide GO term definitions)

Chain A,B,C,D,E,F (CDKN3_HUMAN | Q16667)

molecular function
	GO:0016787	hydrolase activity	Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
	GO:0016791	phosphatase activity	Catalysis of the hydrolysis of phosphoric monoesters, releasing inorganic phosphate.
	GO:0004721	phosphoprotein phosphatase activity	Catalysis of the reaction: a phosphoprotein + H2O = a protein + phosphate. Together with protein kinases, these enzymes control the state of phosphorylation of cell proteins and thereby provide an important mechanism for regulating cellular activity.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0004722	protein serine/threonine phosphatase activity	Catalysis of the reaction: protein serine phosphate + H2O = protein serine + phosphate, and protein threonine phosphate + H2O = protein threonine + phosphate.
	GO:0004725	protein tyrosine phosphatase activity	Catalysis of the reaction: protein tyrosine phosphate + H2O = protein tyrosine + phosphate.
	GO:0008138	protein tyrosine/serine/threonine phosphatase activity	Catalysis of the reactions: protein serine + H2O = protein serine + phosphate; protein threonine phosphate + H2O = protein threonine + phosphate; and protein tyrosine phosphate + H2O = protein tyrosine + phosphate.
biological process
	GO:0000082	G1/S transition of mitotic cell cycle	The mitotic cell cycle transition by which a cell in G1 commits to S phase. The process begins with the build up of G1 cyclin-dependent kinase (G1 CDK), resulting in the activation of transcription of G1 cyclins. The process ends with the positive feedback of the G1 cyclins on the G1 CDK which commits the cell to S phase, in which DNA replication is initiated.
	GO:0007049	cell cycle	The progression of biochemical and morphological phases and events that occur in a cell during successive cell replication or nuclear replication events. Canonically, the cell cycle comprises the replication and segregation of genetic material followed by the division of the cell, but in endocycles or syncytial cells nuclear replication or nuclear division may not be followed by cell division.
	GO:0007050	cell cycle arrest	A regulatory process that halts progression through the cell cycle during one of the normal phases (G1, S, G2, M).
	GO:0016311	dephosphorylation	The process of removing one or more phosphoric (ester or anhydride) residues from a molecule.
	GO:0008285	negative regulation of cell proliferation	Any process that stops, prevents or reduces the rate or extent of cell proliferation.
	GO:0035335	peptidyl-tyrosine dephosphorylation	The removal of phosphoric residues from peptidyl-O-phospho-tyrosine to form peptidyl-tyrosine.
	GO:0006470	protein dephosphorylation	The process of removing one or more phosphoric residues from a protein.
	GO:0000079	regulation of cyclin-dependent protein serine/threonine kinase activity	Any process that modulates the frequency, rate or extent of cyclin-dependent protein serine/threonine kinase activity.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
	GO:0048471	perinuclear region of cytoplasm	Cytoplasm situated near, or occurring around, the nucleus.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		SO4	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]
		AC6	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1fpz)

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]
		Biological Unit 3	[ Jena3D ]
		Biological Unit 4	[ Jena3D ]
		Biological Unit 5	[ Jena3D ]
		Biological Unit 6	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Asym. Unit - sites PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 1 - sites PNG format \| Biol. Unit 2 PNG format \| Biol. Unit 3 PNG format \| Biol. Unit 4 PNG format \| Biol. Unit 5 PNG format \| Biol. Unit 6 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1fpz
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	CDKN3_HUMAN \| Q16667
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	3.1.3.48
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	114550
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	CDKN3_HUMAN \| Q16667
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	CDKN3_HUMAN \| Q16667	:	1fq1

(no "Related Entries Specified in the PDB File" available for 1FPZ)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 6)

Sites (6, 6)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (10, 60)

PROSITE Motifs (1, 6)

Exons (7, 42)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 6)

CATH Domains (1, 6)

Pfam Domains (0, 0)

Gene Ontology (18, 18)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File