Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF BOVINE PROCARBOXYPEPTIDASE A-S6 SUBUNIT III, A HIGHLY STRUCTURED TRUNCATED ZYMOGEN E
 
Authors :  D. C. Pignol, T. Gaboriaud, B. Michon, B. Kerfelec, C. Chapus, J. C. Fontecilla-Camps
Date :  01 Feb 96  (Deposition) - 14 Oct 96  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.70
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Truncated Zymogen E, Serine Protease (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  D. Pignol, C. Gaboriaud, T. Michon, B. Kerfelec, C. Chapus, J. C. Fontecilla-Camps
Crystal Structure Of Bovine Procarboxypeptidase A-S6 Subunit Iii, A Highly Structured Truncated Zymogen E.
Embo J. V. 13 1763 1994
PubMed-ID: 8168476
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - PROCARBOXYPEPTIDASE A-S6
    Chains: A, B
    Fragment: SUBUNIT III
    Organ: PANCREAS
    Organism Common: CATTLE
    Organism Scientific: BOS TAURUS
    Organism Taxid: 9913
    Synonym: BOVINE SUBUNIT III

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit : AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1FON)

(-) Sites  (0, 0)

(no "Site" information available for 1FON)

(-) SS Bonds  (10, 10)

Asymmetric/Biological Unit
No.Residues
1A:28 -A:44
2A:87 -A:90
3A:127 -A:193
4A:158 -A:174
5A:183 -A:214
6B:28 -B:44
7B:87 -B:90
8B:127 -B:193
9B:158 -B:174
10B:183 -B:214

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1FON)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1FON)

(-) PROSITE Motifs  (2, 4)

Asymmetric/Biological Unit (2, 4)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1TRYPSIN_HISPS00134 Serine proteases, trypsin family, histidine active site.CAC3_BOVIN52-57
 		  2A:39-44
B:39-44
2TRYPSIN_SERPS00135 Serine proteases, trypsin family, serine active site.CAC3_BOVIN194-205
 		  2A:181-192
B:181-192

(-) Exons   (0, 0)

(no "Exon" information available for 1FON)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:232
 aligned with CAC3_BOVIN | P05805 from UniProtKB/Swiss-Prot  Length:253

    Alignment length:232
                                    31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251  
           CAC3_BOVIN    22 SWSWQVSLQYEKDGAFHHTCGGSLIAPDWVVTAGHCISTSRTYQVVLGEYDRSVLEGSEQVIPINAGDLFVHPLWNSNCVACGNDIALVKLSRSAQLGDKVQLANLPPAGDILPNEAPCYISGWGRLYTGGPLPDKLQQALLPVVDYEHCSQWDWWGITVKKTMVCAGGDTRSGCNGDSGGPLNCPAADGSWQVHGVTSFVSAFGCNTIKKPTVFTRVSAFIDWIDETIASN 253
               SCOP domains d1fona_ A: Procarboxypeptidase A-S6 subunit III (zymogen E)                                                                                                                                                                              SCOP domains
               CATH domains 1f1fonA02 A:11-111,A:228-240 Trypsin-like serine proteases                                             1fonA01 A:9-10,A:112-227 Trypsin-like serine proteases                                                              1fonA02       CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeeeeeee..eeeeee..eeee..eeee.hhh......eeeeeeeee..eee...eeeee....eee........hhh....eeee............................eeeee..............eeee.....hhhh......hhh....eeee..............eeeee.....eeeeeeeee............eeeeehhh.hhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------TRYPSI----------------------------------------------------------------------------------------------------------------------------------------TRYPSIN_SER ------------------------------------------------ PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1fon A   9 SWSWQVSLQYEKDGAFHHTCGGSLIAPDWVVTAGHCISTSRTYQVVLGEYDRSVLEGSEQVIPINAGDLFVHPLWNSNCVACGNDIALVKLSRSAQLGDKVQLANLPPAGDILPNEAPCYISGWGRLYTGGPLPDKLQQALLPTVDYEHCSQWDWWGITVKKTMVCAGGDTRSGCNGDSGGPLNCPAADGSWQVHGVTSFVSAFGCNTIKKPTVFTRVSAFIDWIDETIASN 240
                                    18        28        38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238  


Chain B from PDB  Type:PROTEIN  Length:232
 aligned with CAC3_BOVIN | P05805 from UniProtKB/Swiss-Prot  Length:253

    Alignment length:232
                                    31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251  
           CAC3_BOVIN    22 SWSWQVSLQYEKDGAFHHTCGGSLIAPDWVVTAGHCISTSRTYQVVLGEYDRSVLEGSEQVIPINAGDLFVHPLWNSNCVACGNDIALVKLSRSAQLGDKVQLANLPPAGDILPNEAPCYISGWGRLYTGGPLPDKLQQALLPVVDYEHCSQWDWWGITVKKTMVCAGGDTRSGCNGDSGGPLNCPAADGSWQVHGVTSFVSAFGCNTIKKPTVFTRVSAFIDWIDETIASN 253
               SCOP domains d1fonb_ B: Procarboxypeptidase A-S6 subunit III (zymogen E)                                                                                                                                                                              SCOP domains
               CATH domains 1f1fonB02 B:11-111,B:228-240 Trypsin-like serine proteases                                             1fonB01 B:9-10,B:112-227 Trypsin-like serine proteases                                                              1fonB02       CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeeeeeee..eeeeee..eeee..eeee.hhh......eeeeeeeee..eee...eeee.....eee........hhh....eeee............................eeeee..............eeee.....hhhh......hhh....eeee..............eeeee.....eeeeeeeee............eeeeehhh.hhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------TRYPSI----------------------------------------------------------------------------------------------------------------------------------------TRYPSIN_SER ------------------------------------------------ PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1fon B   9 SWSWQVSLQYEKDGAFHHTCGGSLIAPDWVVTAGHCISTSRTYQVVLGEYDRSVLEGSEQVIPINAGDLFVHPLWNSNCVACGNDIALVKLSRSAQLGDKVQLANLPPAGDILPNEAPCYISGWGRLYTGGPLPDKLQQALLPTVDYEHCSQWDWWGITVKKTMVCAGGDTRSGCNGDSGGPLNCPAADGSWQVHGVTSFVSAFGCNTIKKPTVFTRVSAFIDWIDETIASN 240
                                    18        28        38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Class: All beta proteins (24004)

(-) CATH Domains  (1, 4)

Asymmetric/Biological Unit
(-)
Class: Mainly Beta (13760)
(-)
Architecture: Beta Barrel (4804)
(-)
Topology: Thrombin, subunit H (1535)
(-)
Homologous Superfamily: Trypsin-like serine proteases (1488)
(-)
Cattle (Bos taurus) (308)
1a1fonA02A:11-111,A:228-240
1b1fonB02B:11-111,B:228-240
1c1fonA01A:9-10,A:112-227
1d1fonB01B:9-10,B:112-227

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1FON)

(-) Gene Ontology  (5, 5)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B   (CAC3_BOVIN | P05805)
molecular function
    GO:0004252    serine-type endopeptidase activity    Catalysis of the hydrolysis of internal, alpha-peptide bonds in a polypeptide chain by a catalytic mechanism that involves a catalytic triad consisting of a serine nucleophile that is activated by a proton relay involving an acidic residue (e.g. aspartate or glutamate) and a basic residue (usually histidine).
biological process
    GO:0007586    digestion    The whole of the physical, chemical, and biochemical processes carried out by multicellular organisms to break down ingested nutrients into components that may be easily absorbed and directed into metabolism.
    GO:0006508    proteolysis    The hydrolysis of proteins into smaller polypeptides and/or amino acids by cleavage of their peptide bonds.
cellular component
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
    GO:0005615    extracellular space    That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1fon)
 
  Sites
(no "Sites" information available for 1fon)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1fon)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1fon
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  CAC3_BOVIN | P05805
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  CAC3_BOVIN | P05805
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        CAC3_BOVIN | P05805: 1pyt

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1FON)