1FCG - JenaLib

Title :   ECTODOMAIN OF HUMAN FC GAMMA RECEPTOR, FCGRIIA

Authors :   K. F. Maxwell, M. S. Powell, T. P. Garrett, P. M. Hogarth

Date :   07 Apr 99 (Deposition) - 12 Apr 00 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.00

Chains :   Asym. Unit : A
Biol. Unit 1: A  (2x)

Keywords :   Fc Receptor, Immunogloulin, Leukocyte, Cd32, Immune System, Membrane Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   K. F. Maxwell, M. S. Powell, M. D. Hulett, P. A. Barton, I. F. Mckenzie, T. P. Garrett, P. M. Hogarth
Crystal Structure Of The Human Leukocyte Fc Receptor, Fc Gammariia.
Nat. Struct. Biol. V. 6 437 1999
PubMed-ID: 10331870 | Reference-DOI: 10.1038/8241
(for further references see the PDB file header)

Compounds

Molecule 1 - PROTEIN (FC RECEPTOR FC(GAMMA)RIIA)
	Cell	:	MONOCYTE
	Cellular Location	:	CELL SURFACE
	Chains	:	A
	Engineered	:	YES
	Expression System	:	SPODOPTERA FRUGIPERDA
	Expression System Cellular Location	:	SECRETED
	Expression System Cell Line	:	SF21
	Expression System Common	:	FALL ARMYWORM
	Expression System Plasmid	:	PVL1392
	Expression System Taxid	:	7108
	Expression System Vector	:	BACULOVIRUS
	Expression System Vector Type	:	VIRUS
	Fragment	:	EXTRACELLULAR DOMAINS
	Mutation	:	YES
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Other Details	:	LOW RESPONDER VARIANT OF FC(GAMMA)RIIA
	Synonym	:	CD32
	Tissue	:	BLOOD

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (2, 2)

Cis Peptide Bonds (1, 1)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (3, 3)

Asymmetric Unit (3, 3)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_054857	Q	63	R	FCG2A_HUMAN	Polymorphism	9427398	A	Q	30	R
2	UniProt	VAR_054858	M	140	V	FCG2A_HUMAN	Polymorphism	4986941	A	M	107	V
3	UniProt	VAR_003955	H	167	R	FCG2A_HUMAN	Polymorphism	1801274	A	H	134	R

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 1 (3, 6)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_054857	Q	63	R	FCG2A_HUMAN	Polymorphism	9427398	A	Q	30	R
2	UniProt	VAR_054858	M	140	V	FCG2A_HUMAN	Polymorphism	4986941	A	M	107	V
3	UniProt	VAR_003955	H	167	R	FCG2A_HUMAN	Polymorphism	1801274	A	H	134	R

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

PROSITE Motifs (0, 0)

Exons (3, 3)

Asymmetric Unit (3, 3)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1a	ENST00000271450	1a	ENSE00001170978	chr1:161475220-161475342	123	FCG2A_HUMAN	1-29	29	0	-	-
1.1g	ENST00000271450	1g	ENSE00000958752	chr1:161475777-161475797	21	FCG2A_HUMAN	29-36	8	0	-	-
1.1j	ENST00000271450	1j	ENSE00001651726	chr1:161476124-161476381	258	FCG2A_HUMAN	36-122	87	1	A:4-89	86
1.3a	ENST00000271450	3a	ENSE00001614571	chr1:161479610-161479864	255	FCG2A_HUMAN	122-207	86	1	A:89-174	86
1.4a	ENST00000271450	4a	ENSE00000958755	chr1:161480624-161480746	123	FCG2A_HUMAN	207-248	42	1	A:174-174	1
1.6a	ENST00000271450	6a	ENSE00001643425	chr1:161483685-161483722	38	FCG2A_HUMAN	248-260	13	0	-	-
1.8h	ENST00000271450	8h	ENSE00001170974	chr1:161487765-161489358	1594	FCG2A_HUMAN	261-317	57	0	-	-

Sequences/Alignments

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:171
 aligned with FCG2A_HUMAN | P12318 from UniProtKB/Swiss-Prot  Length:317

    Alignment length:171
                                    46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206 
          FCG2A_HUMAN    37 APPKAVLKLEPPWINVLQEDSVTLTCQGARSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIMLRCHSWKDKPLVKVTFFQNGKSQKFSHLDPTFSIPQANHSHSGDYHCTGNIGYTLFSSKPVTITVQV 207
               SCOP domains d1fcga1 A:4-88 Fc gamma receptor ectodomain (CD32)                                   d1fcga2 A:89-174 Fc gamma receptor ectodomain (CD32)                                   SCOP domains
               CATH domains 1fcgA01 A:4-89 Immunoglobulins                                                        1fcgA02 A:90-174 Immunoglobulins                                                      CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....eeeee....eee...eeeeeee.........eeeee..eee......eeeee..hhh.eeeeeee........eeeeee...eeeee..........eeeeeeehhh.....eeeee..eeeeee....eeee....hhh.eeeeeeeee..eeee...eee.... Sec.struct. author
                 SAPs(SNPs) --------------------------R----------------------------------------------------------------------------V--------------------------R---------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.1j  PDB: A:4-89 UniProt: 36-122 [INCOMPLETE]                                   ------------------------------------------------------------------------------------1 Transcript 1 (1)
           Transcript 1 (2) -------------------------------------------------------------------------------------Exon 1.3a  PDB: A:89-174 UniProt: 122-207                                              Transcript 1 (2)
                 1fcg A   4 APPKAVLKLEPPWINVLQEDSVTLTCQGARSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLFEWLVLQTPHLEFQEGETIMLRCHSWKDKPLVKVTFFQNGKSQKFSHLDPTFSIPQANHSHSGDYHCTGNIGYTLFSSKPVTITVQV 174
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (1, 2)

CATH Domains (1, 2)

Pfam Domains (0, 0)

Gene Ontology (8, 8)

Asymmetric Unit(hide GO term definitions)

Chain A (FCG2A_HUMAN | P12318)

molecular function
	GO:0019864	IgG binding	Interacting selectively and non-covalently with an immunoglobulin of an IgG isotype.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
	GO:0038096	Fc-gamma receptor signaling pathway involved in phagocytosis	An Fc-gamma receptor signaling pathway that contributes to the endocytic engulfment of external particulate material by phagocytes.
	GO:0002376	immune system process	Any process involved in the development or functioning of the immune system, an organismal system for calibrated responses to potential internal or invasive threats.
cellular component
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

Visualization

Interactive Views

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1fcg)

	Sites
(no "Sites" information available for 1fcg)

	Cis Peptide Bonds
		Glu A:13 - Pro A:14	[ RasMol ]

Biological Unit
	Complete Structure
		Biological Unit 1	[ Jena3D ]

Still Images

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	1fcg
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	FCG2A_HUMAN \| P12318
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Analysis Tools

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	FCG2A_HUMAN \| P12318
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

Description