Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF PLATELET FACTOR 4 MUTANT 1
 
Authors :  J. Yang, M. Doyle, T. Faulk, G. Visentin, R. Aster, B. Edwards
Date :  11 Jul 00  (Deposition) - 26 Aug 03  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.00
Chains :  Asym./Biol. Unit :  A,B,C,D
Keywords :  Platelet Factor 4 Mutant 1, Cytokine (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  J. Yang, M. Doyle, T. Faulk, G. Visentin, R. Aster, B. Edwards
Structure Comparison Of Two Platelet Factor 4 Mutants With The Wild-Type Reveals The Epitopes For The Heparin-Induced Thrombocytopenia Antibodies
To Be Published
PubMed: search
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - PLATELET FACTOR 4
    ChainsA, B, C, D
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPT7-7
    Expression System Taxid562
    MutationYES
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymPF-4, ONCOSTATIN, IROPLACT

 Structural Features

(-) Chains, Units

  1234
Asymmetric/Biological Unit ABCD

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1F9R)

(-) Sites  (0, 0)

(no "Site" information available for 1F9R)

(-) SS Bonds  (8, 8)

Asymmetric/Biological Unit
No.Residues
1A:10 -A:36
2A:12 -A:52
3B:110 -B:136
4B:112 -B:152
5C:210 -C:236
6C:212 -C:252
7D:310 -D:336
8D:312 -D:352

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1F9R)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1F9R)

(-) PROSITE Motifs  (1, 4)

Asymmetric/Biological Unit (1, 4)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1SMALL_CYTOKINES_CXCPS00471 Small cytokines (intercrine/chemokine) C-x-C subfamily signature.PLF4_HUMAN41-85
 
 
 
  4A:10-54
B:110-154
C:210-254
D:310-354

(-) Exons   (2, 8)

Asymmetric/Biological Unit (2, 8)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1ENST000002960291ENSE00001077823chr4:74847841-74847580262PLF4_HUMAN1-31310--
1.2ENST000002960292ENSE00001756309chr4:74847260-74847134127PLF4_HUMAN31-73434A:6-42
B:108-142
C:206-242
D:306-342
37
35
37
37
1.3ENST000002960293ENSE00001077821chr4:74847008-74846794215PLF4_HUMAN73-101294A:42-70
B:142-170
C:242-270
D:342-370
29
29
29
29

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:65
 aligned with PLF4_HUMAN | P02776 from UniProtKB/Swiss-Prot  Length:101

    Alignment length:65
                                    46        56        66        76        86        96     
           PLF4_HUMAN    37 GDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLLES 101
               SCOP domains d1f9ra_ A: Platelet factor 4, PF4                                 SCOP domains
               CATH domains 1f9rA00 A:6-70  [code=2.40.50.40, no name defined]                CATH domains
               Pfam domains ----------------------------------------------------------------- Pfam domains
         Sec.struct. author ..............hhh.eeeeeee.........eeeeee....eee.....hhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----SMALL_CYTOKINES_CXC  PDB: A:10-54            ---------------- PROSITE
           Transcript 1 (1) Exon 1.2  PDB: A:6-42 UniProt: 31-73 ---------------------------- Transcript 1 (1)
           Transcript 1 (2) ------------------------------------Exon 1.3  PDB: A:42-70        Transcript 1 (2)
                 1f9r A   6 GDLQCLCVKTTSQVRPRHITSLEVIKAGPHCAVPQLIATLKNGRKICLDLQAPLYKKIIKKLLES  70
                                    15        25        35        45        55        65     

Chain B from PDB  Type:PROTEIN  Length:63
 aligned with PLF4_HUMAN | P02776 from UniProtKB/Swiss-Prot  Length:101

    Alignment length:63
                                    48        58        68        78        88        98   
           PLF4_HUMAN    39 LQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLLES 101
               SCOP domains d1f9rb_ B: Platelet factor 4, PF4                               SCOP domains
               CATH domains 1f9rB00 B:108-170  [code=2.40.50.40, no name defined]           CATH domains
               Pfam domains --------------------------------------------------------------- Pfam domains
         Sec.struct. author ............hhh.eeeeeee.........eeeeee....eee...hhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --SMALL_CYTOKINES_CXC  PDB: B:110-154          ---------------- PROSITE
           Transcript 1 (1) Exon 1.2  PDB: B:108-142           ---------------------------- Transcript 1 (1)
           Transcript 1 (2) ----------------------------------Exon 1.3  PDB: B:142-170      Transcript 1 (2)
                 1f9r B 108 LQCLCVKTTSQVRPRHITSLEVIKAGPHCAVPQLIATLKNGRKICLDLQAPLYKKIIKKLLES 170
                                   117       127       137       147       157       167   

Chain C from PDB  Type:PROTEIN  Length:65
 aligned with PLF4_HUMAN | P02776 from UniProtKB/Swiss-Prot  Length:101

    Alignment length:65
                                    46        56        66        76        86        96     
           PLF4_HUMAN    37 GDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLLES 101
               SCOP domains d1f9rc_ C: Platelet factor 4, PF4                                 SCOP domains
               CATH domains 1f9rC00 C:206-270  [code=2.40.50.40, no name defined]             CATH domains
               Pfam domains ----------------------------------------------------------------- Pfam domains
         Sec.struct. author ..............hhh.eeeeeee.........eeeeee....eee.....hhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----SMALL_CYTOKINES_CXC  PDB: C:210-254          ---------------- PROSITE
           Transcript 1 (1) Exon 1.2  PDB: C:206-242 [INCOMPLETE]---------------------------- Transcript 1 (1)
           Transcript 1 (2) ------------------------------------Exon 1.3  PDB: C:242-270      Transcript 1 (2)
                 1f9r C 206 GDLQCLCVKTTSQVRPRHITSLEVIKAGPHCAVPQLIATLKNGRKICLDLQAPLYKKIIKKLLES 270
                                   215       225       235       245       255       265     

Chain D from PDB  Type:PROTEIN  Length:65
 aligned with PLF4_HUMAN | P02776 from UniProtKB/Swiss-Prot  Length:101

    Alignment length:65
                                    46        56        66        76        86        96     
           PLF4_HUMAN    37 GDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLLES 101
               SCOP domains d1f9rd_ D: Platelet factor 4, PF4                                 SCOP domains
               CATH domains 1f9rD00 D:306-370  [code=2.40.50.40, no name defined]             CATH domains
               Pfam domains ----------------------------------------------------------------- Pfam domains
         Sec.struct. author ..................eeeeeee.........eeeeee....eeee..hhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----SMALL_CYTOKINES_CXC  PDB: D:310-354          ---------------- PROSITE
           Transcript 1 (1) Exon 1.2  PDB: D:306-342 [INCOMPLETE]---------------------------- Transcript 1 (1)
           Transcript 1 (2) ------------------------------------Exon 1.3  PDB: D:342-370      Transcript 1 (2)
                 1f9r D 306 GDLQCLCVKTTSQVRPRHITSLEVIKAGPHCAVPQLIATLKNGRKICLDLQAPLYKKIIKKLLES 370
                                   315       325       335       345       355       365     

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 4)

Asymmetric/Biological Unit

(-) CATH Domains  (1, 4)

Asymmetric/Biological Unit
(-)
Class: Mainly Beta (13760)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1F9R)

(-) Gene Ontology  (31, 31)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B,C,D   (PLF4_HUMAN | P02776)
molecular function
    GO:0048248    CXCR3 chemokine receptor binding    Interacting selectively and non-covalently with a the CXCR3 chemokine receptor.
    GO:0008009    chemokine activity    The function of a family of small chemotactic cytokines; their name is derived from their ability to induce directed chemotaxis in nearby responsive cells. All chemokines possess a number of conserved cysteine residues involved in intramolecular disulfide bond formation. Some chemokines are considered pro-inflammatory and can be induced during an immune response to recruit cells of the immune system to a site of infection, while others are considered homeostatic and are involved in controlling the migration of cells during normal processes of tissue maintenance or development. Chemokines are found in all vertebrates, some viruses and some bacteria.
    GO:0005125    cytokine activity    Functions to control the survival, growth, differentiation and effector function of tissues and cells.
    GO:0008201    heparin binding    Interacting selectively and non-covalently with heparin, any member of a group of glycosaminoglycans found mainly as an intracellular component of mast cells and which consist predominantly of alternating alpha-(1->4)-linked D-galactose and N-acetyl-D-glucosamine-6-sulfate residues.
biological process
    GO:0007186    G-protein coupled receptor signaling pathway    A series of molecular signals that proceeds with an activated receptor promoting the exchange of GDP for GTP on the alpha-subunit of an associated heterotrimeric G-protein complex. The GTP-bound activated alpha-G-protein then dissociates from the beta- and gamma-subunits to further transmit the signal within the cell. The pathway begins with receptor-ligand interaction, or for basal GPCR signaling the pathway begins with the receptor activating its G protein in the absence of an agonist, and ends with regulation of a downstream cellular process, e.g. transcription. The pathway can start from the plasma membrane, Golgi or nuclear membrane (PMID:24568158 and PMID:16902576).
    GO:0070098    chemokine-mediated signaling pathway    A series of molecular signals initiated by the binding of a chemokine to a receptor on the surface of a cell, and ending with regulation of a downstream cellular process, e.g. transcription.
    GO:0006935    chemotaxis    The directed movement of a motile cell or organism, or the directed growth of a cell guided by a specific chemical concentration gradient. Movement may be towards a higher concentration (positive chemotaxis) or towards a lower concentration (negative chemotaxis).
    GO:0019221    cytokine-mediated signaling pathway    A series of molecular signals initiated by the binding of a cytokine to a receptor on the surface of a cell, and ending with regulation of a downstream cellular process, e.g. transcription.
    GO:0006955    immune response    Any immune system process that functions in the calibrated response of an organism to a potential internal or invasive threat.
    GO:0006954    inflammatory response    The immediate defensive reaction (by vertebrate tissue) to infection or injury caused by chemical or physical agents. The process is characterized by local vasodilation, extravasation of plasma into intercellular spaces and accumulation of white blood cells and macrophages.
    GO:0030595    leukocyte chemotaxis    The movement of a leukocyte in response to an external stimulus.
    GO:0045347    negative regulation of MHC class II biosynthetic process    Any process that stops, prevents, or reduces the frequency, rate or extent of the chemical reactions and pathways resulting in the formation of MHC class II.
    GO:0016525    negative regulation of angiogenesis    Any process that stops, prevents, or reduces the frequency, rate or extent of angiogenesis.
    GO:0045918    negative regulation of cytolysis    Any process that stops, prevents, or reduces the frequency, rate or extent of cytolysis.
    GO:2001240    negative regulation of extrinsic apoptotic signaling pathway in absence of ligand    Any process that stops, prevents or reduces the frequency, rate or extent of extrinsic apoptotic signaling pathway in absence of ligand.
    GO:0045653    negative regulation of megakaryocyte differentiation    Any process that stops, prevents, or reduces the frequency, rate or extent of megakaryocyte differentiation.
    GO:0030168    platelet activation    A series of progressive, overlapping events triggered by exposure of the platelets to subendothelial tissue. These events include shape change, adhesiveness, aggregation, and release reactions. When carried through to completion, these events lead to the formation of a stable hemostatic plug.
    GO:0002576    platelet degranulation    The regulated exocytosis of secretory granules containing preformed mediators such as histamine and serotonin by a platelet.
    GO:0030816    positive regulation of cAMP metabolic process    Any process that activates or increases the frequency, rate or extent of the chemical reactions and pathways involving the nucleotide cAMP (cyclic AMP, adenosine 3',5'-cyclophosphate).
    GO:0043950    positive regulation of cAMP-mediated signaling    Any process which activates, maintains or increases the frequency, rate or extent of cAMP-mediated signaling, a series of molecular signals in which a cell uses cyclic AMP to convert an extracellular signal into a response.
    GO:0010628    positive regulation of gene expression    Any process that increases the frequency, rate or extent of gene expression. Gene expression is the process in which a gene's coding sequence is converted into a mature gene product or products (proteins or RNA). This includes the production of an RNA transcript as well as any processing to produce a mature RNA product or an mRNA or circRNA (for protein-coding genes) and the translation of that mRNA or circRNA into protein. Protein maturation is included when required to form an active form of a product from an inactive precursor form.
    GO:0002690    positive regulation of leukocyte chemotaxis    Any process that activates or increases the frequency, rate, or extent of leukocyte chemotaxis.
    GO:0010744    positive regulation of macrophage derived foam cell differentiation    Any process that increases the rate, frequency or extent of macrophage derived foam cell differentiation. Macrophage derived foam cell differentiation is the process in which a macrophage acquires the specialized features of a foam cell. A foam cell is a type of cell containing lipids in small vacuoles and typically seen in atherosclerotic lesions, as well as other conditions.
    GO:0045651    positive regulation of macrophage differentiation    Any process that activates or increases the frequency, rate or extent of macrophage differentiation.
    GO:0045944    positive regulation of transcription from RNA polymerase II promoter    Any process that activates or increases the frequency, rate or extent of transcription from an RNA polymerase II promoter.
    GO:0032760    positive regulation of tumor necrosis factor production    Any process that activates or increases the frequency, rate, or extent of tumor necrosis factor production.
    GO:0042127    regulation of cell proliferation    Any process that modulates the frequency, rate or extent of cell proliferation.
    GO:0032496    response to lipopolysaccharide    Any process that results in a change in state or activity of an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a lipopolysaccharide stimulus; lipopolysaccharide is a major component of the cell wall of gram-negative bacteria.
cellular component
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
    GO:0005615    extracellular space    That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.
    GO:0031093    platelet alpha granule lumen    The volume enclosed by the membrane of the platelet alpha granule.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1f9r)
 
  Sites
(no "Sites" information available for 1f9r)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1f9r)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1f9r
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  PLF4_HUMAN | P02776
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  PLF4_HUMAN | P02776
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        PLF4_HUMAN | P027761dn3 1f9q 1f9s 1pfm 1pfn 1rhp 4r9w 4r9y 4rau

(-) Related Entries Specified in the PDB File

1f9q WILD-TYPE PLATELET FACTOR 4 STRUCTURE DETERMINED AT -180 DEGREES C
1f9s PLATELET FACTOR 4 MUTANT 2 STRUCTURE DETERMINED AT -180 DEGREES C