1ETP - JenaLib

Asym.Unit - manually (Jmol Viewer)

Asymmetric Unit (Jmol Viewer)

Asym. Unit - sites (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biol. Unit 1 - sites (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Title :   CRYSTAL STRUCTURE OF CYTOCHROME C4 FROM PSEUDOMONAS STUTZERI

Authors :   A. Kadziola, S. Larsen

Date :   23 Jan 96 (Deposition) - 12 Feb 97 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.20

Chains :   Asym. Unit : A,B
Biol. Unit 1: A  (1x)
Biol. Unit 2: B  (1x)

Keywords :   Electron Transport, Cytochrome C4, Diheme Protein, Pseudomonas Stutzeri (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   A. Kadziola, S. Larsen
Crystal Structure Of The Dihaem Cytochrome C4 From Pseudomonas Stutzeri Determined At 2. 2A Resolution.
Structure V. 5 203 1997
PubMed-ID: 9032080 | Reference-DOI: 10.1016/S0969-2126(97)00179-2
(for further references see the PDB file header)

Molecule 1 - CYTOCHROME C4
	Atcc	:	11607
	Chains	:	A, B
	Organism Scientific	:	PSEUDOMONAS STUTZERI
	Organism Taxid	:	316

		1	2
Asymmetric Unit	:	A	B
Biological Unit 1 (1x)	:	A
Biological Unit 2 (1x)	:		B

Summary Information (see also Sequences/Alignments below)

Asymmetric Unit (1, 4)

No.	Name	Count	Type	Full Name
1	HEM	4	Ligand/Ion	PROTOPORPHYRIN IX CONTAINING FE

Biological Unit 1 (1, 2)

No.	Name	Count	Type	Full Name
1	HEM	2	Ligand/Ion	PROTOPORPHYRIN IX CONTAINING FE

Biological Unit 2 (1, 2)

No.	Name	Count	Type	Full Name
1	HEM	2	Ligand/Ion	PROTOPORPHYRIN IX CONTAINING FE

Asymmetric Unit (4, 4)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	VAL A:13 , CYS A:14 , CYS A:17 , HIS A:18 , PRO A:30 , LEU A:32 , TYR A:39 , GLN A:43 , ILE A:47 , ARG A:61 , GLU A:65 , MET A:66 , MET A:69 , ILE A:81 , TYR A:145 , LYS A:148 , GLN A:149 , HEM A:200 , HOH A:205 , HOH A:207 , HOH A:275	BINDING SITE FOR RESIDUE HEM A 199
2	AC2	SOFTWARE	TYR A:39 , LYS A:42 , GLN A:43 , ALA A:118 , CYS A:119 , CYS A:122 , HIS A:123 , PHE A:135 , PRO A:136 , LEU A:138 , TYR A:145 , ARG A:158 , ASN A:160 , ILE A:166 , MET A:167 , ILE A:186 , HEM A:199 , HOH A:206	BINDING SITE FOR RESIDUE HEM A 200
3	AC3	SOFTWARE	PHE A:135 , VAL B:13 , CYS B:14 , CYS B:17 , HIS B:18 , PHE B:29 , PRO B:30 , LEU B:32 , TYR B:39 , GLN B:43 , LEU B:44 , ILE B:47 , ARG B:61 , GLU B:65 , MET B:66 , LEU B:70 , ILE B:81 , TYR B:145 , LYS B:148 , GLN B:149 , HEM B:200 , HOH B:219 , HOH B:300	BINDING SITE FOR RESIDUE HEM B 199
4	AC4	SOFTWARE	ALA A:16 , TYR B:39 , LYS B:42 , GLN B:43 , ALA B:118 , CYS B:119 , CYS B:122 , HIS B:123 , PHE B:135 , PRO B:136 , LEU B:138 , TYR B:145 , ARG B:158 , ASN B:160 , ILE B:166 , MET B:167 , VAL B:170 , HEM B:199 , HOH B:211 , HOH B:220	BINDING SITE FOR RESIDUE HEM B 200

(no "SS Bond" information available for 1ETP)

(no "Cis Peptide Bond" information available for 1ETP)

(no "SAP(SNP)/Variant" information available for 1ETP)

Asymmetric Unit (1, 4)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	CYTC	PS51007	Cytochrome c family profile.	CYC4_PSEST	22-109 118-210	4	A:2-89 B:2-89 A:98-190 B:98-190

Biological Unit 1 (1, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	CYTC	PS51007	Cytochrome c family profile.	CYC4_PSEST	22-109 118-210	2	A:2-89 - A:98-190 -

Biological Unit 2 (1, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	CYTC	PS51007	Cytochrome c family profile.	CYC4_PSEST	22-109 118-210	2	- B:2-89 - B:98-190

(no "Exon" information available for 1ETP)

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:190
 aligned with CYC4_PSEST | Q52369 from UniProtKB/Swiss-Prot  Length:210

    Alignment length:190
                                    30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210
           CYC4_PSEST    21 AGDAEAGQGKVAVCGACHGVDGNSPAPNFPKLAGQGERYLLKQLQDIKAGSTPGAPEGVGRKVLEMTGMLDPLSDQDLEDIAAYFSSQKGSVGYADPALAKQGEKLFRGGKLDQGMPACTGCHAPNGVGNDLAGFPKLGGQHAAYTAKQLTDFREGNRTNDGDTMIMRGVAAKLSNKDIEALSSYIQGLH 210
               SCOP domains d1etpa1 A:1-92 Cytochrome c4                                                                d1etpa2 A:93-190 Cytochrome c4                                                                     SCOP domains
               CATH domains 1etpA01 A:1-91 Cytochrome c                                                                1etpA02 A:92-190 Cytochrome c                                                                       CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhh..hhhhhhhh.................hhhhhhhhhhhhhhhh......................hhhhhhhhhhhhhh...........hhhhhhhhhhhh........hhhhh..................hhhhhhhhhhhhhhh........hhhhhhhh..hhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -CYTC  PDB: A:2-89 UniProt: 22-109                                                       --------CYTC  PDB: A:98-190 UniProt: 118-210                                                          PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1etp A   1 AGDAEAGQGKVAVCGACHGVDGNSPAPNFPKLAGQGERYLLKQLQDIKAGSTPGAPEGVGRKVLEMTGMLDPLSDQDLEDIAAYFSSQKGSVGYADPALAKQGEKLFRGGKLDQGMPACTGCHAPNGVGNDLAGFPKLGGQHAAYTAKQLTDFREGNRTNDGDTMIMRGVAAKLSNKDIEALSSYIQGLH 190
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190

Chain B from PDB  Type:PROTEIN  Length:190
 aligned with CYC4_PSEST | Q52369 from UniProtKB/Swiss-Prot  Length:210

    Alignment length:190
                                    30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210
           CYC4_PSEST    21 AGDAEAGQGKVAVCGACHGVDGNSPAPNFPKLAGQGERYLLKQLQDIKAGSTPGAPEGVGRKVLEMTGMLDPLSDQDLEDIAAYFSSQKGSVGYADPALAKQGEKLFRGGKLDQGMPACTGCHAPNGVGNDLAGFPKLGGQHAAYTAKQLTDFREGNRTNDGDTMIMRGVAAKLSNKDIEALSSYIQGLH 210
               SCOP domains d1etpb1 B:1-92 Cytochrome c4                                                                d1etpb2 B:93-190 Cytochrome c4                                                                     SCOP domains
               CATH domains 1etpB01 B:1-91 Cytochrome c                                                                1etpB02 B:92-190 Cytochrome c                                                                       CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhh..hhhhhhhh.................hhhhhhhhhhhhhhhh......................hhhhhhhhhhhhhh...........hhhhhhhhhhhh........hhhhh..................hhhhhhhhhhhhhhh........hhhhhhhh..hhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -CYTC  PDB: B:2-89 UniProt: 22-109                                                       --------CYTC  PDB: B:98-190 UniProt: 118-210                                                          PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1etp B   1 AGDAEAGQGKVAVCGACHGVDGNSPAPNFPKLAGQGERYLLKQLQDIKAGSTPGAPEGVGRKVLEMTGMLDPLSDQDLEDIAAYFSSQKGSVGYADPALAKQGEKLFRGGKLDQGMPACTGCHAPNGVGNDLAGFPKLGGQHAAYTAKQLTDFREGNRTNDGDTMIMRGVAAKLSNKDIEALSSYIQGLH 190
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: All alpha proteins (14657)

Fold: Cytochrome c (308)

Superfamily: Cytochrome c (308)

Family: Two-domain cytochrome c (6)

Protein domain: Cytochrome c4 (4)

Pseudomonas stutzeri [TaxId: 316] (3)

1a	d1etpa1	A:1-92
1b	d1etpa2	A:93-190
1c	d1etpb1	B:1-92
1d	d1etpb2	B:93-190

Asymmetric Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Mainly Alpha (13335)

Architecture: Orthogonal Bundle (10391)

Topology: Cytochrome Bc1 Complex; Chain D, domain 2 (279)

Homologous Superfamily: Cytochrome c (279)

Pseudomonas stutzeri. Organism_taxid: 316. (1)

1a	1etpA02	A:92-190
1b	1etpB02	B:92-190
1c	1etpA01	A:1-91
1d	1etpB01	B:1-91

(no "Pfam Domain" information available for 1ETP)

Asymmetric Unit(hide GO term definitions)

Chain A,B (CYC4_PSEST | Q52369)

molecular function
	GO:0009055	electron carrier activity	Any molecular entity that serves as an electron acceptor and electron donor in an electron transport chain. An electron transport chain is a process in which a series of electron carriers operate together to transfer electrons from donors to any of several different terminal electron acceptors to generate a transmembrane electrochemical gradient.
	GO:0020037	heme binding	Interacting selectively and non-covalently with heme, any compound of iron complexed in a porphyrin (tetrapyrrole) ring.
	GO:0005506	iron ion binding	Interacting selectively and non-covalently with iron (Fe) ions.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
biological process
	GO:0055114	oxidation-reduction process	A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
cellular component
	GO:0042597	periplasmic space	The region between the inner (cytoplasmic) and outer membrane (Gram-negative Bacteria) or cytoplasmic membrane and cell wall (Fungi and Gram-positive Bacteria).

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		HEM	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1etp)

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Asym. Unit - sites PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 1 - sites PNG format \| Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1etp
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	CYC4_PSEST \| Q52369
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	CYC4_PSEST \| Q52369
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	CYC4_PSEST \| Q52369	:	1m6z 1m70

(no "Related Entries Specified in the PDB File" available for 1ETP)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 4)

Sites (4, 4)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (1, 4)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 4)

CATH Domains (1, 4)

Pfam Domains (0, 0)

Gene Ontology (6, 6)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File