|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 1EP0) |
Sites (0, 0)| (no "Site" information available for 1EP0) |
SS Bonds (0, 0)| (no "SS Bond" information available for 1EP0) |
Cis Peptide Bonds (1, 1)
Asymmetric Unit
|
||||||||
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1EP0) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1EP0) |
Exons (0, 0)| (no "Exon" information available for 1EP0) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:183 aligned with RMLC_METTH | O27818 from UniProtKB/Swiss-Prot Length:185 Alignment length:183 12 22 32 42 52 62 72 82 92 102 112 122 132 142 152 162 172 182 RMLC_METTH 3 EFRFIKTSLDGAIIIEPEVYTDERGYFMETFNEAIFQENGLEVRFVQDNESMSVRGVLRGLHFQREKPQGKLVRVIRGEIFDVAVDLRKNSDTYGEWTGVRLSDENRREFFIPEGFAHGFLALSDECIVNYKCTELYHPEYDSGIPWDDPDIGIDWPLEMVDDLIISEKDRNWKPLRENPVYL 185 SCOP domains d1ep0a_ A: dTDP-4-dehydrorhamnose 3,5-epimerase RmlC SCOP domains CATH domains 1ep0A00 A:3-185 Jelly Rolls CATH domains Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 1ep0 A 3 EFRFIKTSLDGAIIIEPEVYTDERGYFMETFNEAIFQENGLEVRFVQDNESMSVRGVLRGLHFQREKPQGKLVRVIRGEIFDVAVDLRKNSDTYGEWTGVRLSDENRREFFIPEGFAHGFLALSDECIVNYKCTELYHPEYDSGIPWDDPDIGIDWPLEMVDDLIISEKDRNWKPLRENPVYL 185 12 22 32 42 52 62 72 82 92 102 112 122 132 142 152 162 172 182
|
||||||||||||||||||||
SCOP Domains (1, 1)| Asymmetric Unit |
CATH Domains (1, 1)| Asymmetric Unit |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 1EP0) |
Gene Ontology (4, 4)|
Asymmetric Unit(hide GO term definitions) Chain A (RMLC_METTH | O27818)
|
||||||||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|