Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym.Unit - manually
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
collapse expand < >
Image Asym.Unit - manually
Asym.Unit - manually  (Jmol Viewer)
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF THE H219N VARIANT OF KLEBSIELLA AEROGENES UREASE
 
Authors :  M. A. Pearson, I. S. Park, R. A. Schaller, L. O. Michel, P. A. Karplus, R. P. Hausinger
Date :  04 Mar 00  (Deposition) - 08 Sep 00  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.00
Chains :  Asym. Unit :  A,B,C
Biol. Unit 1:  A,B,C  (3x)
Keywords :  Alpha-Beta Barrel, Nickel Metalloenzyme, Hydrolase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  M. A. Pearson, I. S. Park, R. A. Schaller, L. O. Michel, P. A. Karplus, R. P. Hausinger
Kinetic And Structural Characterization Of Urease Active Site Variants.
Biochemistry V. 39 8575 2000
PubMed-ID: 10913264  |  Reference-DOI: 10.1021/BI000613O

(-) Compounds

Molecule 1 - UREASE ALPHA SUBUNIT
    ChainsC
    EC Number3.5.1.5
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Taxid562
    MutationYES
    Organism ScientificKLEBSIELLA AEROGENES
    Organism Taxid28451
 
Molecule 2 - UREASE BETA SUBUNIT
    ChainsB
    EC Number3.5.1.5
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Taxid562
    Organism ScientificKLEBSIELLA AEROGENES
    Organism Taxid28451
 
Molecule 3 - UREASE GAMMA SUBUNIT
    ChainsA
    EC Number3.5.1.5
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Taxid562
    Organism ScientificKLEBSIELLA AEROGENES
    Organism Taxid28451

 Structural Features

(-) Chains, Units

  123
Asymmetric Unit ABC
Biological Unit 1 (3x)ABC

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 3)

Asymmetric Unit (2, 3)
No.NameCountTypeFull Name
1KCX1Mod. Amino AcidLYSINE NZ-CARBOXYLIC ACID
2NI2Ligand/IonNICKEL (II) ION
Biological Unit 1 (1, 3)
No.NameCountTypeFull Name
1KCX3Mod. Amino AcidLYSINE NZ-CARBOXYLIC ACID
2NI-1Ligand/IonNICKEL (II) ION

(-) Sites  (2, 2)

Asymmetric Unit (2, 2)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREHOH C:500 , HOH C:501 , KCX C:1217 , HIS C:1246 , HIS C:1272 , GLY C:1277 , NI C:4775BINDING SITE FOR RESIDUE NI C 4774
2AC2SOFTWAREHOH C:500 , HOH C:502 , HIS C:1134 , HIS C:1136 , KCX C:1217 , ASP C:1360 , NI C:4774BINDING SITE FOR RESIDUE NI C 4775

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1EJS)

(-) Cis Peptide Bonds  (3, 3)

Asymmetric Unit
No.Residues
1Ala C:1281 -Pro C:1282
2Leu C:1302 -Pro C:1303
3Gln C:1469 -Pro C:1470

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1EJS)

(-) PROSITE Motifs  (3, 3)

Asymmetric Unit (3, 3)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1UREASE_1PS01120 Urease nickel ligands signature.URE1_ENTAE127-140  1C:1127-1140
2UREASE_3PS51368 Urease domain profile.URE1_ENTAE129-567  1C:1129-1567
3UREASE_2PS00145 Urease active site.URE1_ENTAE317-333  1C:1317-1333
Biological Unit 1 (3, 9)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1UREASE_1PS01120 Urease nickel ligands signature.URE1_ENTAE127-140  3C:1127-1140
2UREASE_3PS51368 Urease domain profile.URE1_ENTAE129-567  3C:1129-1567
3UREASE_2PS00145 Urease active site.URE1_ENTAE317-333  3C:1317-1333

(-) Exons   (0, 0)

(no "Exon" information available for 1EJS)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:100
 aligned with URE3_ENTAE | P18316 from UniProtKB/Swiss-Prot  Length:100

    Alignment length:100
                                    10        20        30        40        50        60        70        80        90       100
          URE3_ENTAE      1 MELTPREKDKLLLFTAALVAERRLARGLKLNYPESVALISAFIMEGARDGKSVASLMEEGRHVLTREQVMEGVPEMIPDIQVEATFPDGSKLVTVHNPII  100
               SCOP domains d1ejsa_ A: Urease, gamma-subunit                                                                     SCOP domains
               CATH domains 1ejsA00 A:3001-3100 Urease, subunit A                                                                CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhh.hhhh...hhhhhh.eeeeeeee..eeeeeeee.... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------- Transcript
                1ejs A 3001 MELTPREKDKLLLFTAALVAERRLARGLKLNYPESVALISAFIMEGARDGKSVASLMEEGRHVLTREQVMEGVPEMIPDIQVEATFPDGSKLVTVHNPII 3100
                                  3010      3020      3030      3040      3050      3060      3070      3080      3090      3100

Chain B from PDB  Type:PROTEIN  Length:101
 aligned with URE2_ENTAE | P18315 from UniProtKB/Swiss-Prot  Length:106

    Alignment length:101
                                    10        20        30        40        50        60        70        80        90       100 
          URE2_ENTAE      1 MIPGEYHVKPGQIALNTGRATCRVVVENHGDRPIQVGSHYHFAEVNPALKFDRQQAAGYRLNIPAGTAVRFEPGQKREVELVAFAGHRAVFGFRGEVMGPL  101
               SCOP domains d1ejsb_ B: Urease, beta-subunit                                                                       SCOP domains
               CATH domains 1ejsB00 B:2001-2101 Urease, subunit B                                                                 CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....ee....eee......eeeeeeee.....eeee...hhhhh...ee........eee......eeee....eeeeeeee.....ee........ee. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------- Transcript
                1ejs B 2001 MIPGEYHVKPGQIALNTGRATCRVVVENHGDRPIQVGSHYHFAEVNPALKFDRQQAAGYRLNIPAGTAVRFEPGQKREVELVAFAGHRAVFGFRGEVMGPL 2101
                                  2010      2020      2030      2040      2050      2060      2070      2080      2090      2100 

Chain C from PDB  Type:PROTEIN  Length:566
 aligned with URE1_ENTAE | P18314 from UniProtKB/Swiss-Prot  Length:567

    Alignment length:566
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       441       451       461       471       481       491       501       511       521       531       541       551       561      
          URE1_ENTAE      2 SNISRQAYADMFGPTVGDKVRLADTELWIEVEDDLTTYGEEVKFGGGKVIRDGMGQGQMLAADCVDLVLTNALIVDHWGIVKADIGVKDGRIFAIGKAGNPDIQPNVTIPIGAATEVIAAEGKIVTAGGIDTHIHWICPQQAEEALVSGVTTMVGGGTGPAAGTHATTCTPGPWYISRMLQAADSLPVNIGLLGKGNVSQPDALREQVAAGVIGLKIHEDWGATPAAIDCALTVADEMDIQVALHSDTLNESGFVEDTLAAIGGRTIHTFHTEGAGGGHAPDIITACAHPNILPSSTNPTLPYTLNTIDEHLDMLMVCHHLDPDIAEDVAFAESRIRRETIAAEDVLHDLGAFSLTSSDSQAMGRVGEVILRTWQVAHRMKVQRGALAEETGDNDNFRVKRYIAKYTINPALTHGIAHEVGSIEVGKLADLVVWSPAFFGVKPATVIKGGMIAIAPMGDINASIPTPQPVHYRPMFGALGSARHHCRLTFLSQAAAANGVAERLNLRSAIAVVKGCRTVQKADMVHNSLQPNITVDAQTYEVRVDGELITSEPADVLPMAQRYFLF  567
               SCOP domains d1ejsc1 C:1002-1129,C:1423-1475 alpha-Subunit of urease                                                                         d1ejsc2 C:1130-1422,C:1476-1567 alpha-subunit of urease, catalytic domain                                                                                                                                                                                                                            d1ejsc1 C:1002-1129,C:1423-1475                      d1ejsc2 C:1130-1422,C:1476-1567 alpha-subunit of urease, catalytic domain                    SCOP domains
               CATH domains 1ejsC01 C:1002-1128,C:1423-1480 Urease, subunit C, domain 1                                                                    1ejsC02 C:1129-1422,C:1481-1566 Metal-dependent hydrolases                                                                                                                                                                                                                                            1ejsC01 C:1002-1128,C:1423-1480                           1ejsC02 C:1129-1422,C:1481-1566 Metal-dependent hydrolases                            - CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeehhhhhhhhh.....eee......eee..ee.........................hhhhh..eeeeeeeeee..eeeeeeeeee..eeeeee.ee.........ee.....eeee....eeee.eeeeeee....hhhhhhhhhheeeeeee....hhhhhhh...hhhhhhhhhhhhhh....eeee.......hhhhhhhhhhhh..eeeee.hhh.hhhhhhhhhhhhhhhh.eeeee........hhhhhhhhhh...eee............hhhhhhhh..eeeeee........hhhhhhhhhhhhhh.....hhhhhhhhhh..hhhhhhhhhhhhhh....eee..........hhhhhhhhhhhhhhhhhh.........hhhhhhhhhhh.hhhhhhhh................eeeehhhhh.....eeee..eeeeeee.............eeee.hhhhhhhhhhhheeeehhhhhhhhhhhhhh...eeee.......hhhhh........eee......eee..ee.................. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) -----------------------------------------------------------------------------------------------------------------------------UREASE_1      --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------UREASE_2         ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE (1)
                PROSITE (2) -------------------------------------------------------------------------------------------------------------------------------UREASE_3  PDB: C:1129-1567 UniProt: 129-567                                                                                                                                                                                                                                                                                                                                                                                                             PROSITE (2)
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1ejs C 1002 SNISRQAYADMFGPTVGDKVRLADTELWIEVEDDLTTYGEEVKFGGGKVIRDGMGQGQMLAADCVDLVLTNALIVDHWGIVKADIGVKDGRIFAIGKAGNPDIQPNVTIPIGAATEVIAAEGKIVTAGGIDTHIHWICPQQAEEALVSGVTTMVGGGTGPAAGTHATTCTPGPWYISRMLQAADSLPVNIGLLGKGNVSQPDALREQVAAGVIGLkINEDWGATPAAIDCALTVADEMDIQVALHSDTLNESGFVEDTLAAIGGRTIHTFHTEGAGGGHAPDIITACAHPNILPSSTNPTLPYTLNTIDEHLDMLMVCHHLDPDIAEDVAFAESRIRRETIAAEDVLHDLGAFSLTSSDSQAMGRVGEVILRTWQVAHRMKVQRGALAEETGDNDNFRVKRYIAKYTINPALTHGIAHEVGSIEVGKLADLVVWSPAFFGVKPATVIKGGMIAIAPMGDINASIPTPQPVHYRPMFGALGSARHHCRLTFLSQAAAANGVAERLNLRSAIAVVKGCRTVQKADMVHNSLQPNITVDAQTYEVRVDGELITSEPADVLPMAQRYFLF 1567
                                  1011      1021      1031      1041      1051      1061      1071      1081      1091      1101      1111      1121      1131      1141      1151      1161      1171      1181      1191      1201      1211     |1221      1231      1241      1251      1261      1271      1281      1291      1301      1311      1321      1331      1341      1351      1361      1371      1381      1391      1401      1411      1421      1431      1441      1451      1461      1471      1481      1491      1501      1511      1521      1531      1541      1551      1561      
                                                                                                                                                                                                                                                1217-KCX                                                                                                                                                                                                                                                                                                                                                          

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (4, 4)

Asymmetric Unit

(-) CATH Domains  (4, 4)

Asymmetric Unit
(-)
Class: Alpha Beta (26913)
(-)
Class: Mainly Beta (13760)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1EJS)

(-) Gene Ontology  (10, 21)

Asymmetric Unit(hide GO term definitions)
Chain A   (URE3_ENTAE | P18316)
molecular function
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
    GO:0016151    nickel cation binding    Interacting selectively and non-covalently with nickel (Ni) cations.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0009039    urease activity    Catalysis of the reaction: urea + H2O = CO2 + 2 NH3.
biological process
    GO:0043419    urea catabolic process    The chemical reactions and pathways resulting in the breakdown of urea, the water soluble compound O=C-(NH2)2.
    GO:0019627    urea metabolic process    The chemical reactions and pathways involving urea, the water soluble compound O=C-(NH2)2.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.

Chain B   (URE2_ENTAE | P18315)
molecular function
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
    GO:0009039    urease activity    Catalysis of the reaction: urea + H2O = CO2 + 2 NH3.
biological process
    GO:0043419    urea catabolic process    The chemical reactions and pathways resulting in the breakdown of urea, the water soluble compound O=C-(NH2)2.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.

Chain C   (URE1_ENTAE | P18314)
molecular function
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
    GO:0016810    hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds    Catalysis of the hydrolysis of any carbon-nitrogen bond, C-N, with the exception of peptide bonds.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0016151    nickel cation binding    Interacting selectively and non-covalently with nickel (Ni) cations.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0009039    urease activity    Catalysis of the reaction: urea + H2O = CO2 + 2 NH3.
biological process
    GO:0006807    nitrogen compound metabolic process    The chemical reactions and pathways involving organic or inorganic compounds that contain nitrogen.
    GO:0043419    urea catabolic process    The chemical reactions and pathways resulting in the breakdown of urea, the water soluble compound O=C-(NH2)2.
    GO:0019627    urea metabolic process    The chemical reactions and pathways involving urea, the water soluble compound O=C-(NH2)2.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    KCX  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    NI  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Ala C:1281 - Pro C:1282   [ RasMol ]  
    Gln C:1469 - Pro C:1470   [ RasMol ]  
    Leu C:1302 - Pro C:1303   [ RasMol ]  
 
Biological Unit
  Complete Structure
    Biological Unit 1  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1ejs
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  URE1_ENTAE | P18314
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  URE2_ENTAE | P18315
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  URE3_ENTAE | P18316
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  3.5.1.5
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  URE1_ENTAE | P18314
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  URE2_ENTAE | P18315
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  URE3_ENTAE | P18316
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        URE1_ENTAE | P183141a5k 1a5l 1a5m 1a5n 1a5o 1ef2 1ejr 1ejt 1eju 1ejv 1ejw 1ejx 1fwa 1fwb 1fwc 1fwd 1fwe 1fwf 1fwg 1fwh 1fwi 1fwj 1kra 1krb 1krc 2kau 4ep8 4epb 4epd 4epe
        URE2_ENTAE | P183151a5k 1a5l 1a5m 1a5n 1a5o 1ef2 1ejr 1ejt 1eju 1ejv 1ejw 1ejx 1fwa 1fwb 1fwc 1fwd 1fwe 1fwf 1fwg 1fwh 1fwi 1fwj 1kra 1krb 1krc 2kau 4ep8 4epb 4epd 4epe
        URE3_ENTAE | P183161a5k 1a5l 1a5m 1a5n 1a5o 1ef2 1ejr 1ejt 1eju 1ejv 1ejw 1ejx 1fwa 1fwb 1fwc 1fwd 1fwe 1fwf 1fwg 1fwh 1fwi 1fwj 1kra 1krb 1krc 2kau 4ep8 4epb 4epd 4epe

(-) Related Entries Specified in the PDB File

1ejr 1ejt 1eju 1ejv 1ejw 1ejx