|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 1)
Asymmetric/Biological Unit (1, 1)
|
Sites (0, 0)| (no "Site" information available for 1EHD) |
SS Bonds (8, 8)
Asymmetric/Biological Unit
|
||||||||||||||||||||||||||||||||||||
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1EHD) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1EHD) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1EHD) |
Exons (0, 0)| (no "Exon" information available for 1EHD) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:89 aligned with Q9S7B3_URTDI | Q9S7B3 from UniProtKB/TrEMBL Length:112 Alignment length:89 33 43 53 63 73 83 93 103 Q9S7B3_URTDI 24 QRCGSQGGGGTCPGLRCCSIWGWCGDSEPYCGRTCENKCWSGERSDHRCGAAVGNPPCGQDRCCSVHGWCGGGNDYCSGGNCQYRCSSS 112 SCOP domains d1ehda1 A:1-45 Isolectin VI d1ehda2 A:46-89 Isolectin VI SCOP domains CATH domains ----------------------------------------------------------------------------------------- CATH domains Pfam domains ----------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------------------------------------- PROSITE Transcript ----------------------------------------------------------------------------------------- Transcript 1ehd A 1 xRCGSQGGGATCPGLRCCSIWGWCGDSEPYCGRTCENKCWSGERSDHRCGAAVGNPPCGQDRCCSVHGWCGGGNDYCSGGKCQYRCSSS 89 | 10 20 30 40 50 60 70 80 | 1-PCA
|
||||||||||||||||||||
SCOP Domains (1, 2)
Asymmetric/Biological Unit
|
CATH Domains (0, 0)| (no "CATH Domain" information available for 1EHD) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 1EHD) |
Gene Ontology (1, 1)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A (Q9S7B3_URTDI | Q9S7B3)
|
||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|