Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  SOLUTION STRUCTURE OF THE ENA-VASP HOMOLOGY 1 (EVH1) DOMAIN OF HUMAN VASODILATOR-STIMULATED PHOSPHOPROTEIN (VASP)
 
Authors :  L. Ball, R. Kuhne, B. Hoffmann, A. Hafner, P. Schmieder, R. Volkmer-Eng M. Hof, M. Wahl, J. Schneider-Mergener, U. Walter, H. Oschkinat, T. Ja
Date :  17 Feb 00  (Deposition) - 20 Sep 00  (Release) - 25 Jul 12  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (15x)
NMR Structure *:  A  (1x)
Keywords :  Evh1, Vasp-Ena, Poly-Proline-Binding Domain, Signaling Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  L. J. Ball, R. Kuhne, B. Hoffmann, A. Hafner, P. Schmieder, R. Volkmer-Engert, M. Hof, M. Wahl, J. Schneider-Mergener, U. Walter H. Oschkinat, T. Jarchau
Dual Epitope Recognition By The Vasp Evh1 Domain Modulates Polyproline Ligand Specificity And Binding Affinity.
Embo J. V. 19 4903 2000
PubMed-ID: 10990454  |  Reference-DOI: 10.1093/EMBOJ/19.18.4903

(-) Compounds

Molecule 1 - VASODILATOR-STIMULATED PHOSPHOPROTEIN
    ChainsA
    EngineeredYES
    Expression SystemESCHERICHIA COLI BL21
    Expression System StrainBL21
    Expression System Taxid511693
    Expression System VectorPGEX-4T-1
    FragmentEVH1 DOMAIN
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymVASP

 Structural Features

(-) Chains, Units

  1
NMR Structure (15x)A
NMR Structure * (1x)A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1EGX)

(-) Sites  (0, 0)

(no "Site" information available for 1EGX)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1EGX)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1EGX)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (1, 1)

NMR Structure (1, 1)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_048929A104TVASP_HUMANPolymorphism10415373AA104T

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
NMR Structure * (1, 1)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_048929A104TVASP_HUMANPolymorphism10415373AA104T

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (1, 1)

NMR Structure (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1WH1PS50229 WH1 domain profile.VASP_HUMAN1-113  1A:1-113
NMR Structure * (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1WH1PS50229 WH1 domain profile.VASP_HUMAN1-113  1A:1-113

(-) Exons   (4, 4)

NMR Structure (4, 4)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1ENST000002459321ENSE00001375539chr19:46010688-46011034347VASP_HUMAN1-221A:1-22
1.2ENST000002459322ENSE00001742627chr19:46020921-46021092172VASP_HUMAN2-59581A:2-5958
1.3ENST000002459323ENSE00000858230chr19:46021187-46021352166VASP_HUMAN60-115561A:60-11556
1.4ENST000002459324ENSE00000858231chr19:46024580-4602466485VASP_HUMAN115-143291A:115-1151
1.5ENST000002459325ENSE00000858232chr19:46025426-4602547550VASP_HUMAN143-160180--
1.6ENST000002459326ENSE00000858233chr19:46025598-46025839242VASP_HUMAN160-240810--
1.7ENST000002459327ENSE00001635606chr19:46025976-46026076101VASP_HUMAN241-274340--
1.8ENST000002459328ENSE00000858235chr19:46026902-4602695352VASP_HUMAN274-291180--
1.9ENST000002459329ENSE00000858236chr19:46027099-4602713537VASP_HUMAN292-304130--
1.10ENST0000024593210ENSE00000858237chr19:46027355-4602740046VASP_HUMAN304-319160--
1.11ENST0000024593211ENSE00000858238chr19:46027828-4602791891VASP_HUMAN319-349310--
1.12ENST0000024593212ENSE00000858239chr19:46029204-4602926158VASP_HUMAN350-369200--
1.13ENST0000024593213ENSE00001112676chr19:46029398-46030236839VASP_HUMAN369-380120--

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:115
 aligned with VASP_HUMAN | P50552 from UniProtKB/Swiss-Prot  Length:380

    Alignment length:115
                                    10        20        30        40        50        60        70        80        90       100       110     
           VASP_HUMAN     1 MSETVICSSRATVMLYDDGNKRWLPAGTGPQAFSRVQIYHNPTANSFRVVGRKMQPDQQVVINCAIVRGVKYNQATPNFHQWRDARQVWGLNFGSKEDAAQFAAGMASALEALEG 115
               SCOP domains d1egxa_ A: Vasodilator-stimulated phosphoprotein (VASP)                                                             SCOP domains
               CATH domains 1egxA00 A:1-115 Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB)                         CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eeeeeeee..ee.................eeeeeeee....eeeeeeee......eeeeeee............eeeee....eeeeee.hhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------T----------- SAPs(SNPs)
                    PROSITE WH1  PDB: A:1-113 UniProt: 1-113                                                                                 -- PROSITE
           Transcript 1 (1) 1.---------------------------------------------------------Exon 1.3  PDB: A:60-115 UniProt: 60-115                  Transcript 1 (1)
           Transcript 1 (2) -Exon 1.2  PDB: A:2-59 UniProt: 2-59                       -------------------------------------------------------1 Transcript 1 (2)
                 1egx A   1 MSETVICSSRATVMLYDDGNKRWLPAGTGPQAFSRVQIYHNPTANSFRVVGRKMQPDQQVVINCAIVRGVKYNQATPNFHQWRDARQVWGLNFGSKEDAAQFAAGMASALEALEG 115
                                    10        20        30        40        50        60        70        80        90       100       110     

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

NMR Structure

(-) CATH Domains  (1, 1)

NMR Structure
(-)
Class: Mainly Beta (13760)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1EGX)

(-) Gene Ontology  (26, 26)

NMR Structure(hide GO term definitions)
Chain A   (VASP_HUMAN | P50552)
molecular function
    GO:0017124    SH3 domain binding    Interacting selectively and non-covalently with a SH3 domain (Src homology 3) of a protein, small protein modules containing approximately 50 amino acid residues found in a great variety of intracellular or membrane-associated proteins.
    GO:0003779    actin binding    Interacting selectively and non-covalently with monomeric or multimeric forms of actin, including actin filaments.
    GO:0005522    profilin binding    Interacting selectively and non-covalently with profilin, an actin-binding protein that forms a complex with G-actin and prevents it from polymerizing to form F-actin.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
    GO:0030036    actin cytoskeleton organization    A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of cytoskeletal structures comprising actin filaments and their associated proteins.
    GO:0008154    actin polymerization or depolymerization    Assembly or disassembly of actin filaments by the addition or removal of actin monomers from a filament.
    GO:0007411    axon guidance    The chemotaxis process that directs the migration of an axon growth cone to a specific target site in response to a combination of attractive and repulsive cues.
    GO:0034329    cell junction assembly    A cellular process that results in the aggregation, arrangement and bonding together of a set of components to form a cell junction.
    GO:0001843    neural tube closure    The last step in the formation of the neural tube, where the paired neural folds are brought together and fuse at the dorsal midline.
    GO:0030838    positive regulation of actin filament polymerization    Any process that activates or increases the frequency, rate or extent of actin polymerization.
    GO:0051289    protein homotetramerization    The formation of a protein homotetramer, a macromolecular structure consisting of four noncovalently associated identical subunits.
cellular component
    GO:0015629    actin cytoskeleton    The part of the cytoskeleton (the internal framework of a cell) composed of actin and associated proteins. Includes actin cytoskeleton-associated complexes.
    GO:0005923    bicellular tight junction    An occluding cell-cell junction that is composed of a branching network of sealing strands that completely encircles the apical end of each cell in an epithelial sheet; the outer leaflets of the two interacting plasma membranes are seen to be tightly apposed where sealing strands are present. Each sealing strand is composed of a long row of transmembrane adhesion proteins embedded in each of the two interacting plasma membranes.
    GO:0030054    cell junction    A cellular component that forms a specialized region of connection between two or more cells or between a cell and the extracellular matrix. At a cell junction, anchoring proteins extend through the plasma membrane to link cytoskeletal proteins in one cell to cytoskeletal proteins in neighboring cells or to proteins in the extracellular matrix.
    GO:0042995    cell projection    A prolongation or process extending from a cell, e.g. a flagellum or axon.
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005856    cytoskeleton    Any of the various filamentous elements that form the internal framework of cells, and typically remain after treatment of the cells with mild detergent to remove membrane constituents and soluble components of the cytoplasm. The term embraces intermediate filaments, microfilaments, microtubules, the microtrabecular lattice, and other structures characterized by a polymeric filamentous nature and long-range order within the cell. The various elements of the cytoskeleton not only serve in the maintenance of cellular shape but also have roles in other cellular functions, including cellular movement, cell division, endocytosis, and movement of organelles.
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
    GO:0070062    extracellular exosome    A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
    GO:0030175    filopodium    Thin, stiff, actin-based protrusion extended by the leading edge of a motile cell such as a crawling fibroblast or amoeba, or an axonal or dendritic growth cone, or a dendritic shaft.
    GO:0031527    filopodium membrane    The portion of the plasma membrane surrounding a filopodium.
    GO:0005925    focal adhesion    Small region on the surface of a cell that anchors the cell to the extracellular matrix and that forms a point of termination of actin filaments.
    GO:0030027    lamellipodium    A thin sheetlike process extended by the leading edge of a migrating cell or extending cell process; contains a dense meshwork of actin filaments.
    GO:0031258    lamellipodium membrane    The portion of the plasma membrane surrounding a lamellipodium.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1egx)
 
  Sites
(no "Sites" information available for 1egx)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1egx)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1egx
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  VASP_HUMAN | P50552
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  VASP_HUMAN | P50552
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        VASP_HUMAN | P505521jng 1usd 1use 2pav 2pbd 3chw

(-) Related Entries Specified in the PDB File

1evh EVH1 DOMAIN FROM MURINE ENABLED IN COMPLEX WITH ACTA PEPTIDE RELATED ID: 18569 RELATED DB: BMRB
1qc6 EVH1 DOMAIN FROM ENA/VASP-LIKE PROTEIN IN COMPLEX WITH ACTA