1EF1 - JenaLib

Asym.Unit - manually (Jmol Viewer)

Asymmetric Unit (Jmol Viewer)

Asym. Unit - sites (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biol. Unit 1 - sites (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Biological Unit 3 (Jmol Viewer)

Title :   CRYSTAL STRUCTURE OF THE MOESIN FERM DOMAIN/TAIL DOMAIN COMPLEX

Authors :   M. A. Pearson, D. Reczek, A. Bretscher, P. A. Karplus

Date :   04 Feb 00 (Deposition) - 10 May 00 (Release) - 13 Jul 11 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.90

Chains :   Asym. Unit : A,B,C,D
Biol. Unit 1: A,B,C,D  (1x)
Biol. Unit 2: B,D  (2x)
Biol. Unit 3: A,C  (2x)

Keywords :   Membrane, Ferm Domain, Tail Domain, Membrane Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   M. A. Pearson, D. Reczek, A. Bretscher, P. A. Karplus
Structure Of The Erm Protein Moesin Reveals The Ferm Domain Fold Masked By An Extended Actin Binding Tail Domain.
Cell(Cambridge, Mass. ) V. 101 259 2000
PubMed-ID: 10847681 | Reference-DOI: 10.1016/S0092-8674(00)80836-3

Molecule 1 - MOESIN
	Chains	:	A, B
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Taxid	:	562
	Fragment	:	N-TERMINAL FERM DOMAIN
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606

Molecule 2 - MOESIN
	Chains	:	C, D
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Taxid	:	562
	Fragment	:	C-TERMINAL TAIL DOMAIN
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606

		1	2	3	4
Asymmetric Unit	:	A	B	C	D
Biological Unit 1 (1x)	:	A	B	C	D
Biological Unit 2 (2x)	:		B		D
Biological Unit 3 (2x)	:	A		C

Summary Information (see also Sequences/Alignments below)

Asymmetric Unit (2, 18)

No.	Name	Count	Type	Full Name
1	MSE	16	Mod. Amino Acid	SELENOMETHIONINE
2	SO4	2	Ligand/Ion	SULFATE ION

Biological Unit 1 (2, 18)

No.	Name	Count	Type	Full Name
1	MSE	16	Mod. Amino Acid	SELENOMETHIONINE
2	SO4	2	Ligand/Ion	SULFATE ION

Biological Unit 2 (2, 18)

No.	Name	Count	Type	Full Name
1	MSE	16	Mod. Amino Acid	SELENOMETHIONINE
2	SO4	2	Ligand/Ion	SULFATE ION

Biological Unit 3 (2, 18)

No.	Name	Count	Type	Full Name
1	MSE	16	Mod. Amino Acid	SELENOMETHIONINE
2	SO4	2	Ligand/Ion	SULFATE ION

Asymmetric Unit (2, 2)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	GLN A:95 , ASP A:96 , HOH A:726	BINDING SITE FOR RESIDUE SO4 A 2001
2	AC2	SOFTWARE	GLN B:95 , ASP B:96 , ILE B:97 , HOH B:1726	BINDING SITE FOR RESIDUE SO4 B 3001

(no "SS Bond" information available for 1EF1)

Asymmetric Unit

No.	Residues
1	Ser A:74	-	Pro A:75
2	Ser B:74	-	Pro B:75

Asymmetric Unit (1, 2)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_078026	R	171	W	MOES_HUMAN	Disease (IMD50)	---	A/B	R	171	W

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 1 (1, 2)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_078026	R	171	W	MOES_HUMAN	Disease (IMD50)	---	A/B	R	171	W

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 2 (1, 2)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_078026	R	171	W	MOES_HUMAN	Disease (IMD50)	---	B	R	171	W

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 3 (1, 2)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_078026	R	171	W	MOES_HUMAN	Disease (IMD50)	---	A	R	171	W

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Asymmetric Unit (3, 6)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	FERM_3	PS50057	FERM domain profile.	MOES_HUMAN	5-295	2	A:5-295 B:5-295
2	FERM_1	PS00660	FERM domain signature 1.	MOES_HUMAN	58-88	2	A:58-88 B:58-88
3	FERM_2	PS00661	FERM domain signature 2.	MOES_HUMAN	176-205	2	A:176-205 B:176-205

Biological Unit 1 (3, 6)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	FERM_3	PS50057	FERM domain profile.	MOES_HUMAN	5-295	2	A:5-295 B:5-295
2	FERM_1	PS00660	FERM domain signature 1.	MOES_HUMAN	58-88	2	A:58-88 B:58-88
3	FERM_2	PS00661	FERM domain signature 2.	MOES_HUMAN	176-205	2	A:176-205 B:176-205

Biological Unit 2 (3, 6)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	FERM_3	PS50057	FERM domain profile.	MOES_HUMAN	5-295	2	- B:5-295
2	FERM_1	PS00660	FERM domain signature 1.	MOES_HUMAN	58-88	2	- B:58-88
3	FERM_2	PS00661	FERM domain signature 2.	MOES_HUMAN	176-205	2	- B:176-205

Biological Unit 3 (3, 6)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	FERM_3	PS50057	FERM domain profile.	MOES_HUMAN	5-295	2	A:5-295 -
2	FERM_1	PS00660	FERM domain signature 1.	MOES_HUMAN	58-88	2	A:58-88 -
3	FERM_2	PS00661	FERM domain signature 2.	MOES_HUMAN	176-205	2	A:176-205 -

Asymmetric Unit (10, 20)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1	ENST00000360270	1	ENSE00001464657	X:64887537-64887720	184	MOES_HUMAN	1-4	4	2	A:4-4 B:4-4 - -	1 1 - -
1.2	ENST00000360270	2	ENSE00001758231	X:64936680-64936763	84	MOES_HUMAN	5-32	28	2	A:5-32 B:5-32 - -	28 28 - -
1.3	ENST00000360270	3	ENSE00000978535	X:64947676-64947771	96	MOES_HUMAN	33-64	32	2	A:33-64 B:33-64 - -	32 32 - -
1.4	ENST00000360270	4	ENSE00000978536	X:64949300-64949574	275	MOES_HUMAN	65-156	92	2	A:65-156 B:65-156 - -	92 92 - -
1.5	ENST00000360270	5	ENSE00000978537	X:64950969-64951052	84	MOES_HUMAN	156-184	29	2	A:156-184 B:156-184 - -	29 29 - -
1.6	ENST00000360270	6	ENSE00000978538	X:64951700-64951846	147	MOES_HUMAN	184-233	50	2	A:184-233 B:184-233 - -	50 50 - -
1.7	ENST00000360270	7	ENSE00000978539	X:64953046-64953142	97	MOES_HUMAN	233-265	33	2	A:233-265 B:233-265 - -	33 33 - -
1.8	ENST00000360270	8	ENSE00001707735	X:64955129-64955292	164	MOES_HUMAN	266-320	55	2	A:266-297 B:266-297 - -	32 32 - -
1.9a	ENST00000360270	9a	ENSE00001022049	X:64956657-64956787	131	MOES_HUMAN	320-364	45	0	-	-
1.10	ENST00000360270	10	ENSE00000978541	X:64957040-64957200	161	MOES_HUMAN	364-417	54	0	-	-
1.11	ENST00000360270	11	ENSE00000978542	X:64958387-64958479	93	MOES_HUMAN	418-448	31	0	-	-
1.12	ENST00000360270	12	ENSE00000978543	X:64958832-64959056	225	MOES_HUMAN	449-523	75	2	- - C:488-523 D:488-523	- - 36 36
1.13b	ENST00000360270	13b	ENSE00001840481	X:64959591-64961791	2201	MOES_HUMAN	524-577	54	2	- - C:524-577 D:524-577	- - 54 54

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:294
 aligned with MOES_HUMAN | P26038 from UniProtKB/Swiss-Prot  Length:577

    Alignment length:294
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293    
           MOES_HUMAN     4 TISVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWFFGLQYQDTKGFSTWLKLNKKVTAQDVRKESPLLFKFRAKFYPEDVSEELIQDITQRLFFLQVKEGILNDDIYCPPETAVLLASYAVQSKYGDFNKEVHKSGYLAGDKLLPQRVLEQHKLNKDQWEERIQVWHEEHRGMLREDAVLEYLKIAQDLEMYGVNYFSIKNKKGSELWLGVDALGLNIYEQNDRLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRKP 297
               SCOP domains d1ef1a3 A:4-87 Moesin                                                               d1ef1a1 A:88-198 Moesin                                                                                        d1ef1a2 A:199-297 Moesin                                                                            SCOP domains
               CATH domains 1ef1A01 A:4-82                                                                 1ef1A02 A:83-199  [code=1.20.80.10, no name defined]                                                                 -1ef1A03 A:201-297 Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB)     CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .eeeeeee..eeeeeee....hhhhhhhhhhhhhh..hhh.eeeeee.....eee......hhhh.......eeeeeee.....hhhhhh.hhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhh..................hhhhhhhh..hhhhhhhhhhhhhhhh...hhhhhhhhhhhhhh.......eeeeee.....eeeeeee..eeeeee........eeee...eeeeeee..eeeeee.......eeee..hhhhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) -----------------------------------------------------------------------------------------------------------------------------------------------------------------------W------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (1) -FERM_3  PDB: A:5-295 UniProt: 5-295                                                                                                                                                                                                                                                                -- PROSITE (1)
                PROSITE (2) ------------------------------------------------------FERM_1  PDB: A:58-88           ---------------------------------------------------------------------------------------FERM_2  PDB: A:176-205        -------------------------------------------------------------------------------------------- PROSITE (2)
           Transcript 1 (1) 1Exon 1.2  PDB: A:5-32       Exon 1.3  PDB: A:33-64          Exon 1.4  PDB: A:65-156 UniProt: 65-156                                                     ---------------------------Exon 1.6  PDB: A:184-233 UniProt: 184-233         --------------------------------Exon 1.8  PDB: A:266-297         Transcript 1 (1)
           Transcript 1 (2) --------------------------------------------------------------------------------------------------------------------------------------------------------Exon 1.5  PDB: A:156-184     ------------------------------------------------Exon 1.7  PDB: A:233-265         -------------------------------- Transcript 1 (2)
                 1ef1 A   4 TISVRVTTmDAELEFAIQPNTTGKQLFDQVVKTIGLREVWFFGLQYQDTKGFSTWLKLNKKVTAQDVRKESPLLFKFRAKFYPEDVSEELIQDITQRLFFLQVKEGILNDDIYCPPETAVLLASYAVQSKYGDFNKEVHKSGYLAGDKLLPQRVLEQHKLNKDQWEERIQVWHEEHRGmLREDAVLEYLKIAQDLEmYGVNYFSIKNKKGSELWLGVDALGLNIYEQNDRLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCmGNHELYmRRRKP 297
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193      |203       213       223       233       243       253       263       273       283 |     293    
                                   12-MSE                                                                                                                                                                   182-MSE           200-MSE                                                                              285-MSE  |     
                                                                                                                                                                                                                                                                                                                          292-MSE

Chain B from PDB  Type:PROTEIN  Length:294
 aligned with MOES_HUMAN | P26038 from UniProtKB/Swiss-Prot  Length:577

    Alignment length:294
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293    
           MOES_HUMAN     4 TISVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWFFGLQYQDTKGFSTWLKLNKKVTAQDVRKESPLLFKFRAKFYPEDVSEELIQDITQRLFFLQVKEGILNDDIYCPPETAVLLASYAVQSKYGDFNKEVHKSGYLAGDKLLPQRVLEQHKLNKDQWEERIQVWHEEHRGMLREDAVLEYLKIAQDLEMYGVNYFSIKNKKGSELWLGVDALGLNIYEQNDRLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRKP 297
               SCOP domains d1ef1b3 B:4-87 Moesin                                                               d1ef1b1 B:88-198 Moesin                                                                                        d1ef1b2 B:199-297 Moesin                                                                            SCOP domains
               CATH domains 1ef1B01 B:4-82                                                                 1ef1B02 B:83-199  [code=1.20.80.10, no name defined]                                                                 -1ef1B03 B:201-291                                                                          ------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .eeeeee....eeeeee....hhhhhhhhhhhhhh..hhh.eeeeee.....eee.................eeeeeee.....hhhhhh.hhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhh..................hhhhhhhh..hhhhhhhhhhhhhhhh...hhhhhhhhhhhhhh.......eeeeee.....eeeeeee..eeeeee........eeee...eeeeeee..eeeeee.......eeee..hhhhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) -----------------------------------------------------------------------------------------------------------------------------------------------------------------------W------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (1) -FERM_3  PDB: B:5-295 UniProt: 5-295                                                                                                                                                                                                                                                                -- PROSITE (1)
                PROSITE (2) ------------------------------------------------------FERM_1  PDB: B:58-88           ---------------------------------------------------------------------------------------FERM_2  PDB: B:176-205        -------------------------------------------------------------------------------------------- PROSITE (2)
           Transcript 1 (1) 1Exon 1.2  PDB: B:5-32       Exon 1.3  PDB: B:33-64          Exon 1.4  PDB: B:65-156 UniProt: 65-156                                                     ---------------------------Exon 1.6  PDB: B:184-233 UniProt: 184-233         --------------------------------Exon 1.8  PDB: B:266-297         Transcript 1 (1)
           Transcript 1 (2) --------------------------------------------------------------------------------------------------------------------------------------------------------Exon 1.5  PDB: B:156-184     ------------------------------------------------Exon 1.7  PDB: B:233-265         -------------------------------- Transcript 1 (2)
                 1ef1 B   4 TISVRVTTmDAELEFAIQPNTTGKQLFDQVVKTIGLREVWFFGLQYQDTKGFSTWLKLNKKVTAQDVRKESPLLFKFRAKFYPEDVSEELIQDITQRLFFLQVKEGILNDDIYCPPETAVLLASYAVQSKYGDFNKEVHKSGYLAGDKLLPQRVLEQHKLNKDQWEERIQVWHEEHRGmLREDAVLEYLKIAQDLEmYGVNYFSIKNKKGSELWLGVDALGLNIYEQNDRLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCmGNHELYmRRRKP 297
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193      |203       213       223       233       243       253       263       273       283 |     293    
                                   12-MSE                                                                                                                                                                   182-MSE           200-MSE                                                                              285-MSE  |     
                                                                                                                                                                                                                                                                                                                          292-MSE

Chain C from PDB  Type:PROTEIN  Length:90
 aligned with MOES_HUMAN | P26038 from UniProtKB/Swiss-Prot  Length:577

    Alignment length:90
                                   497       507       517       527       537       547       557       567       577
           MOES_HUMAN   488 AEASADLRADAMAKDRSEEERTTEAEKNERVQKHLKALTSELANARDESKKTANDMIHAENMRLGRDKYKTLRQIRQGNTKQRIDEFESM 577
               SCOP domains d1ef1c_ C: Moesin tail domain                                                              SCOP domains
               CATH domains ------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ...............hhhhhh.hhhhhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhh..hhhhhhhhhh..hhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (1) ------------------------------------------------------------------------------------------ PROSITE (1)
                PROSITE (2) ------------------------------------------------------------------------------------------ PROSITE (2)
           Transcript 1 (1) Exon 1.12  PDB: C:488-523           Exon 1.13b  PDB: C:524-577 UniProt: 524-577            Transcript 1 (1)
           Transcript 1 (2) ------------------------------------------------------------------------------------------ Transcript 1 (2)
                 1ef1 C 488 AEASADLRADAMAKDRSEEERTTEAEKNERVQKHLKALTSELANARDESKKTANDmIHAENmRLGRDKYKTLRQIRQGNTKQRIDEFESm 577
                                   497       507       517       527       537     | 547 |     557       567       577
                                                                                 543-MSE |                         577-MSE
                                                                                       549-MSE

Chain D from PDB  Type:PROTEIN  Length:90
 aligned with MOES_HUMAN | P26038 from UniProtKB/Swiss-Prot  Length:577

    Alignment length:90
                                   497       507       517       527       537       547       557       567       577
           MOES_HUMAN   488 AEASADLRADAMAKDRSEEERTTEAEKNERVQKHLKALTSELANARDESKKTANDMIHAENMRLGRDKYKTLRQIRQGNTKQRIDEFESM 577
               SCOP domains d1ef1d_ D: Moesin tail domain                                                              SCOP domains
               CATH domains ------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ...............hhhhhh.hhhhhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhh..hhhhhhhhhh..hhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (1) ------------------------------------------------------------------------------------------ PROSITE (1)
                PROSITE (2) ------------------------------------------------------------------------------------------ PROSITE (2)
           Transcript 1 (1) Exon 1.12  PDB: D:488-523           Exon 1.13b  PDB: D:524-577 UniProt: 524-577            Transcript 1 (1)
           Transcript 1 (2) ------------------------------------------------------------------------------------------ Transcript 1 (2)
                 1ef1 D 488 AEASADLRADAMAKDRSEEERTTEAEKNERVQKHLKALTSELANARDESKKTANDmIHAENmRLGRDKYKTLRQIRQGNTKQRIDEFESm 577
                                   497       507       517       527       537     | 547 |     557       567       577
                                                                                 543-MSE |                         577-MSE
                                                                                       549-MSE

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

(no "Pfam Domain" information available for 1EF1)

Asymmetric Unit(hide GO term definitions)

Chain A,B,C,D (MOES_HUMAN | P26038)

molecular function
	GO:0003779	actin binding	Interacting selectively and non-covalently with monomeric or multimeric forms of actin, including actin filaments.
	GO:0050839	cell adhesion molecule binding	Interacting selectively and non-covalently with a cell adhesion molecule.
	GO:0008092	cytoskeletal protein binding	Interacting selectively and non-covalently with any protein component of any cytoskeleton (actin, microtubule, or intermediate filament cytoskeleton).
	GO:0003725	double-stranded RNA binding	Interacting selectively and non-covalently with double-stranded RNA.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0019901	protein kinase binding	Interacting selectively and non-covalently with a protein kinase, any enzyme that catalyzes the transfer of a phosphate group, usually from ATP, to a protein substrate.
	GO:0005102	receptor binding	Interacting selectively and non-covalently with one or more specific sites on a receptor molecule, a macromolecule that undergoes combination with a hormone, neurotransmitter, drug or intracellular messenger to initiate a change in cell function.
	GO:0005200	structural constituent of cytoskeleton	The action of a molecule that contributes to the structural integrity of a cytoskeletal structure.
biological process
	GO:0071394	cellular response to testosterone stimulus	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a testosterone stimulus.
	GO:0061028	establishment of endothelial barrier	The establishment of a barrier between endothelial cell layers, such as those in the brain, lung or intestine, to exert specific and selective control over the passage of water and solutes, thus allowing formation and maintenance of compartments that differ in fluid and solute composition.
	GO:0045198	establishment of epithelial cell apical/basal polarity	The specification and formation of the apicobasal polarity of an epithelial cell.
	GO:0022612	gland morphogenesis	The process in which the anatomical structures of a gland are generated and organized.
	GO:0007159	leukocyte cell-cell adhesion	The attachment of a leukocyte to another cell via adhesion molecules.
	GO:0050900	leukocyte migration	The movement of a leukocyte within or between different tissues and organs of the body.
	GO:0022614	membrane to membrane docking	The initial attachment of a membrane to a target membrane, mediated by proteins protruding from the two membranes. Docking requires only that the membranes come close enough for the proteins to interact and adhere.
	GO:0006928	movement of cell or subcellular component	The directed, self-propelled movement of a cell or subcellular component without the involvement of an external agent such as a transporter or a pore.
	GO:1903364	positive regulation of cellular protein catabolic process	Any process that activates or increases the frequency, rate or extent of cellular protein catabolic process.
	GO:2000643	positive regulation of early endosome to late endosome transport	Any process that activates or increases the frequency, rate or extent of early endosome to late endosome transport.
	GO:0010628	positive regulation of gene expression	Any process that increases the frequency, rate or extent of gene expression. Gene expression is the process in which a gene's coding sequence is converted into a mature gene product or products (proteins or RNA). This includes the production of an RNA transcript as well as any processing to produce a mature RNA product or an mRNA or circRNA (for protein-coding genes) and the translation of that mRNA or circRNA into protein. Protein maturation is included when required to form an active form of a product from an inactive precursor form.
	GO:0071803	positive regulation of podosome assembly	Any process that activates or increases the rate or extent of podosome assembly.
	GO:1902966	positive regulation of protein localization to early endosome	Any process that activates or increases the frequency, rate or extent of protein localization to early endosome.
	GO:0008360	regulation of cell shape	Any process that modulates the surface configuration of a cell.
	GO:0008361	regulation of cell size	Any process that modulates the size of a cell.
	GO:2000401	regulation of lymphocyte migration	Any process that modulates the frequency, rate or extent of lymphocyte migration.
	GO:1902115	regulation of organelle assembly	Any process that modulates the frequency, rate or extent of organelle assembly.
cellular component
	GO:0045177	apical part of cell	The region of a polarized cell that forms a tip or is distal to a base. For example, in a polarized epithelial cell, the apical region has an exposed surface and lies opposite to the basal lamina that separates the epithelium from other tissue.
	GO:0016324	apical plasma membrane	The region of the plasma membrane located at the apical end of the cell.
	GO:0016323	basolateral plasma membrane	The region of the plasma membrane that includes the basal end and sides of the cell. Often used in reference to animal polarized epithelial membranes, where the basal membrane is the part attached to the extracellular matrix, or in plant cells, where the basal membrane is defined with respect to the zygotic axis.
	GO:0072562	blood microparticle	A phospholipid microvesicle that is derived from any of several cell types, such as platelets, blood cells, endothelial cells, or others, and contains membrane receptors as well as other proteins characteristic of the parental cell. Microparticles are heterogeneous in size, and are characterized as microvesicles free of nucleic acids.
	GO:0071944	cell periphery	The part of a cell encompassing the cell cortex, the plasma membrane, and any external encapsulating structures.
	GO:0042995	cell projection	A prolongation or process extending from a cell, e.g. a flagellum or axon.
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005856	cytoskeleton	Any of the various filamentous elements that form the internal framework of cells, and typically remain after treatment of the cells with mild detergent to remove membrane constituents and soluble components of the cytoplasm. The term embraces intermediate filaments, microfilaments, microtubules, the microtrabecular lattice, and other structures characterized by a polymeric filamentous nature and long-range order within the cell. The various elements of the cytoskeleton not only serve in the maintenance of cellular shape but also have roles in other cellular functions, including cellular movement, cell division, endocytosis, and movement of organelles.
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
	GO:0005615	extracellular space	That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.
	GO:0019898	extrinsic component of membrane	The component of a membrane consisting of gene products and protein complexes that are loosely bound to one of its surfaces, but not integrated into the hydrophobic region.
	GO:0030175	filopodium	Thin, stiff, actin-based protrusion extended by the leading edge of a motile cell such as a crawling fibroblast or amoeba, or an axonal or dendritic growth cone, or a dendritic shaft.
	GO:0005925	focal adhesion	Small region on the surface of a cell that anchors the cell to the extracellular matrix and that forms a point of termination of actin filaments.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005902	microvillus	Thin cylindrical membrane-covered projections on the surface of an animal cell containing a core bundle of actin filaments. Present in especially large numbers on the absorptive surface of intestinal cells.
	GO:0031528	microvillus membrane	The portion of the plasma membrane surrounding a microvillus.
	GO:0043209	myelin sheath	An electrically insulating fatty layer that surrounds the axons of many neurons. It is an outgrowth of glial cells: Schwann cells supply the myelin for peripheral neurons while oligodendrocytes supply it to those of the central nervous system.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
	GO:0048471	perinuclear region of cytoplasm	Cytoplasm situated near, or occurring around, the nucleus.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
	GO:0031143	pseudopodium	A temporary protrusion or retractile process of a cell, associated with flowing movements of the protoplasm, and serving for locomotion and feeding.
	GO:0001931	uropod	A membrane projection with related cytoskeletal components at the trailing edge of a cell in the process of migrating or being activated, found on the opposite side of the cell from the leading edge or immunological synapse, respectively.
	GO:0031982	vesicle	Any small, fluid-filled, spherical organelle enclosed by membrane.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		MSE	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		SO4	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
		Ser A:74 - Pro A:75	[ RasMol ]
		Ser B:74 - Pro B:75	[ RasMol ]

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]
		Biological Unit 3	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Asym. Unit - sites PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 1 - sites PNG format \| Biol. Unit 2 PNG format \| Biol. Unit 3 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1ef1
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	MOES_HUMAN \| P26038
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	300988
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	MOES_HUMAN \| P26038
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	MOES_HUMAN \| P26038	:	1e5w 1sgh

(no "Related Entries Specified in the PDB File" available for 1EF1)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (2, 18)

Sites (2, 2)

SS Bonds (0, 0)

Cis Peptide Bonds (2, 2)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (1, 2)

PROSITE Motifs (3, 6)

Exons (10, 20)

Sequences/Alignments

Classification and Annotation

SCOP Domains (4, 8)

CATH Domains (3, 6)

Pfam Domains (0, 0)

Gene Ontology (48, 48)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File