1DUW - JenaLib

Title :   STRUCTURE OF NONAHEME CYTOCHROME C

Authors :   S. Umhau, G. Fritz, K. Diederichs, J. Breed, P. M. Kroneck, W. Welte

Date :   19 Jan 00 (Deposition) - 21 Mar 01 (Release) - 13 Jul 11 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.89

Chains :   Asym. Unit : A
Biol. Unit 1: A  (1x)
Biol. Unit 2: A  (2x)

Keywords :   Heme, Electron Transport, Cytochrome C, Hydrogenase, Hmc Operon (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   S. Umhau, G. Fritz, K. Diederichs, J. Breed, W. Welte, P. M. Kroneck
Three-Dimensional Structure Of The Nonaheme Cytochrome C From Desulfovibrio Desulfuricans Essex In The Fe(Iii) State At 1. 89 A Resolution.
Biochemistry V. 40 1308 2001
PubMed-ID: 11170457 | Reference-DOI: 10.1021/BI001479A

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (2, 10)

Sites (10, 10)

Asymmetric Unit (10, 10)

No.	Name	Evidence	Residues	Description
01	AC1	SOFTWARE	CYS A:50 , HIS A:52 , THR A:53 , VAL A:57 , CYS A:59 , CYS A:62 , HIS A:63 , GLU A:70 , GLY A:71 , ARG A:78 , ALA A:79 , MET A:80 , ARG A:88 , PRO A:94 , VAL A:95 , HOH A:1112 , HOH A:1269 , HOH A:1376	BINDING SITE FOR RESIDUE HEM A 293
02	AC2	SOFTWARE	MET A:16 , PHE A:17 , PRO A:18 , ALA A:29 , MET A:30 , PRO A:32 , ALA A:33 , MET A:80 , HIS A:81 , CYS A:97 , HIS A:101 , ARG A:122 , TRP A:126 , CYS A:127 , CYS A:130 , HIS A:131 , ARG A:231 , PRO A:239 , SER A:243 , HOH A:1005 , HOH A:1009	BINDING SITE FOR RESIDUE HEM A 294
03	AC3	SOFTWARE	THR A:105 , ARG A:108 , GLU A:110 , CYS A:111 , CYS A:114 , HIS A:115 , VAL A:118 , PRO A:120 , LYS A:121 , ARG A:122 , TRP A:126 , ILE A:208 , ASP A:211 , PHE A:217 , HIS A:218 , THR A:223 , LEU A:224 , THR A:227 , HOH A:1030 , HOH A:1272 , HOH A:1314 , HOH A:1387 , HOH A:1409	BINDING SITE FOR RESIDUE HEM A 295
04	AC4	SOFTWARE	SER A:8 , ALA A:10 , ILE A:14 , MET A:16 , PHE A:35 , HIS A:37 , HIS A:40 , ILE A:44 , CYS A:47 , CYS A:50 , HIS A:51 , PRO A:56 , ALA A:58 , CYS A:59 , HEM A:297 , HOH A:1057 , HOH A:1066 , HOH A:1073 , HOH A:1076 , HOH A:1077 , HOH A:1179 , HOH A:1189 , HOH A:1246 , HOH A:1282	BINDING SITE FOR RESIDUE HEM A 296
05	AC5	SOFTWARE	ASN A:36 , HIS A:40 , LYS A:43 , THR A:49 , VAL A:95 , SER A:96 , CYS A:97 , CYS A:100 , HIS A:101 , GLN A:104 , LYS A:212 , LEU A:213 , ALA A:216 , HEM A:296 , HOH A:1012 , HOH A:1025 , HOH A:1061 , HOH A:1067 , HOH A:1093 , HOH A:1094 , HOH A:1122 , HOH A:1151	BINDING SITE FOR RESIDUE HEM A 297
06	AC6	SOFTWARE	CYS A:228 , HIS A:230 , ARG A:231 , LYS A:240 , CYS A:241 , CYS A:244 , HIS A:245 , ASN A:255 , ARG A:256 , PRO A:257 , ALA A:262 , LEU A:265 , GLN A:266 , HOH A:1022 , HOH A:1068 , HOH A:1287	BINDING SITE FOR RESIDUE HEM A 298
07	AC7	SOFTWARE	LEU A:164 , ASN A:165 , ILE A:183 , ASP A:184 , ALA A:185 , LEU A:186 , ALA A:187 , ASP A:188 , LYS A:189 , TYR A:190 , LYS A:260 , TYR A:263 , HIS A:264 , MET A:268 , HIS A:271 , LYS A:280 , ASN A:281 , CYS A:284 , CYS A:287 , HIS A:288 , HOH A:1014 , HOH A:1134	BINDING SITE FOR RESIDUE HEM A 299
08	AC8	SOFTWARE	PRO A:178 , PHE A:195 , HIS A:197 , LEU A:224 , CYS A:225 , CYS A:228 , HIS A:229 , ALA A:236 , LYS A:240 , CYS A:241 , TYR A:263 , HEM A:301 , HOH A:1003 , HOH A:1020 , HOH A:1052 , HOH A:1342 , HOH A:1405	BINDING SITE FOR RESIDUE HEM A 300
09	AC9	SOFTWARE	ASP A:7 , CYS A:47 , CYS A:114 , ILE A:183 , SER A:193 , PHE A:195 , THR A:196 , ARG A:199 , HIS A:200 , SER A:203 , LEU A:204 , ARG A:207 , GLN A:266 , CYS A:267 , CYS A:270 , HIS A:271 , MET A:274 , VAL A:276 , PRO A:279 , HEM A:300 , HOH A:1013 , HOH A:1050 , HOH A:1290	BINDING SITE FOR RESIDUE HEM A 301
10	BC1	SOFTWARE	GLY A:27 , ALA A:29 , LYS A:31 , MET A:142 , THR A:237 , HOH A:1103 , HOH A:1250	BINDING SITE FOR RESIDUE GOL A 302

SS Bonds (0, 0)

Cis Peptide Bonds (2, 2)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (0, 0)

Sequences/Alignments

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:289
 aligned with Q9XCU0_DESDE | Q9XCU0 from UniProtKB/TrEMBL  Length:323

    Alignment length:289
                                    44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314         
         Q9XCU0_DESDE    35 EPTDSGAPSAIVMFPVSAKPNPKGAAMKPAVFNHLAHEKKIANCETCHHTGDPVACSTCHTTEGKAEGNFVTLDRAMHATNIAKRAKGNTPVSCVSCHEQQTKERRECAGCHAIVTPKRDQAWCATCHNVTSSMTPEQMQQGIKGKLPPDQNEALAAETVLNHKPVQPLTAMQGPYKVSIDALADKYEPSNFTHRRHMASLMERIKGDKLAEAFHNKPETLCATCHHRSPLSATPPKCGSCHTKEIDPANPNRPNLKAAYHLQCMGCHQGMNVGRPKNTDCTTCHKARP 323
               SCOP domains d1duwa_ A: Nine-heme cytochrome c                                                                                                                                                                                                                                                                 SCOP domains
               CATH domains 1duwA02 A:4-99,A:130-167 Cytochrome C3                                                          1duwA01 A:100-129,A:168-292   1duwA02 A:4-99,A:130-167 Cytochrome C31duwA01 A:100-129,A:168-292 Cytochrome C3                                                                                     CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..........eee................eeehhhhhhhhh.hhhhh.......hhhhh.....hhhhh..hhhhhhhh.............hhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhh......hhhhhhhhhh...hhhhhhhhhhhhhhhh......hhhhh...eee.........eeehhhhhhhhhhhhhh.hhhhhhhh...hhhhhhh...........hhhhh.............hhhhhhhhhhhhhhhhh........hhhhhh.... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1duw A   4 EPTDSGAPSAIVMFPVSAKPNPKGAAMKPAVFNHLAHEKKIANCETCHHTGDPVACSTCHTTEGKAEGNFVTLDRAMHATNIAKRAKGNTPVSCVSCHEQQTKERRECAGCHAIVTPKRDQAWCATCHNVTSSMTPEQMQQGIKGKLPPDQNEALAAETVLNHKPVQPLTAMQGPYKVSIDALADKYEPSNFTHRRHMASLMERIKGDKLAEAFHNKPETLCATCHHRSPLSATPPKCGSCHTKEIDPANPNRPNLKAAYHLQCMGCHQGMNVGRPKNTDCTTCHKARP 292
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (1, 1)

CATH Domains (1, 2)

Pfam Domains (0, 0)

Gene Ontology (3, 3)

Asymmetric Unit(hide GO term definitions)

Chain A (Q9XCU0_DESDE | Q9XCU0)


GO:0009055	electron carrier activity	Any molecular entity that serves as an electron acceptor and electron donor in an electron transport chain. An electron transport chain is a process in which a series of electron carriers operate together to transfer electrons from donors to any of several different terminal electron acceptors to generate a transmembrane electrochemical gradient.
GO:0020037	heme binding	Interacting selectively and non-covalently with heme, any compound of iron complexed in a porphyrin (tetrapyrrole) ring.
GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.

Visualization

Interactive Views

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		GOL	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		HEM	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]
		AC6	[ RasMol ]	+environment [ RasMol ]
		AC7	[ RasMol ]	+environment [ RasMol ]
		AC8	[ RasMol ]	+environment [ RasMol ]
		AC9	[ RasMol ]	+environment [ RasMol ]
		BC1	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
		Arg A:278 - Pro A:279	[ RasMol ]
		Asn A:253 - Pro A:254	[ RasMol ]

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]

Still Images

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	1duw
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	Q9XCU0_DESDE \| Q9XCU0
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/TrEMBL

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Description