1DU3 - JenaLib

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:90
 aligned with TR10B_HUMAN | O14763 from UniProtKB/Swiss-Prot  Length:440

    Alignment length:103
                                    83        93       103       113       123       133       143       153       163       173   
          TR10B_HUMAN    74 SSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDI 176
               SCOP domains d1du3a1 A:21-61                          d1du3a2 A:62-101                        d             1du3a3 A SCOP domains
               CATH domains 1du3A02 A:21-61                          1du3A01 A:62-101                        ---------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...........eee......eee.....ee..........ee.......eeeee........eeee....eee..eeeeee.-------------........ Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) ----------------------TNFR_NGFR_2  PDB: A:43-84 UniProt: 96-137 TNFR_NGFR_2  PDB: A:85-123              PROSITE (1)
                PROSITE (2) -----------------------TNFR_NGFR_1  PDB: A:44-84 UniProt: 97-137--------------------------------------- PROSITE (2)
                PROSITE (3) ---------------------------------------------------------------TNFR_NGFR_1  PDB: A:84-123               PROSITE (3)
           Transcript 2 (1) Exon 2.3a  -------------------------------------Exon 2.5  PDB: A:69-102 [INCOMPLETE]  ----------------- Transcript 2 (1)
           Transcript 2 (2) ----------Exon 2.4  PDB: A:31-69 UniProt: 84-122 ------------------------------------Exon 2.6c          Transcript 2 (2)
                 1du3 A  21 SSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRK-------------DCTPWSDI 123
                                    30        40        50        60        70        80        90       100 |       -     | 120   
                                                                                                           102           116

Chain B from PDB  Type:PROTEIN  Length:110
 aligned with TR10B_HUMAN | O14763 from UniProtKB/Swiss-Prot  Length:440

    Alignment length:110
                                    83        93       103       113       123       133       143       153       163       173       183
          TR10B_HUMAN    74 SSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIECVHKES 183
               SCOP domains d1du3b1 B:21-61                          d1du3b2 B:62-101                        d1du3b3 B:102-130             SCOP domains
               CATH domains 1du3B03 B:21-61                          1du3B01 B:62-101                        1du3B02 B:102-130             CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...........eee......eee.....ee..........ee.......eeeee........eeee...ee.........ee............................ Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) ----------------------TNFR_NGFR_2  PDB: B:43-84 UniProt: 96-137 TNFR_NGFR_2  PDB: B:85-125               ----- PROSITE (1)
                PROSITE (2) -----------------------TNFR_NGFR_1  PDB: B:44-84 UniProt: 97-137---------------------------------------------- PROSITE (2)
                PROSITE (3) ---------------------------------------------------------------TNFR_NGFR_1  PDB: B:84-125                ----- PROSITE (3)
           Transcript 2 (1) Exon 2.3a  -------------------------------------Exon 2.5  PDB: B:69-106               ------------------------ Transcript 2 (1)
           Transcript 2 (2) ----------Exon 2.4  PDB: B:31-69 UniProt: 84-122 ------------------------------------Exon 2.6c  PDB: B:106-130 Transcript 2 (2)
                 1du3 B  21 SSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIECVHKES 130
                                    30        40        50        60        70        80        90       100       110       120       130

Chain C from PDB  Type:PROTEIN  Length:90
 aligned with TR10B_HUMAN | O14763 from UniProtKB/Swiss-Prot  Length:440

    Alignment length:103
                                    83        93       103       113       123       133       143       153       163       173   
          TR10B_HUMAN    74 SSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDI 176
               SCOP domains d1du3c1 C:21-61                          d1du3c2 C:62-101                        d             1du3c3 C SCOP domains
               CATH domains 1du3C02 C:21-61                          1du3C01 C:62-101                        ---------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhh....ee........ee..........................eeeee........eeee................-------------........ Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) ----------------------TNFR_NGFR_2  PDB: C:43-84 UniProt: 96-137 TNFR_NGFR_2  PDB: C:85-123              PROSITE (1)
                PROSITE (2) -----------------------TNFR_NGFR_1  PDB: C:44-84 UniProt: 97-137--------------------------------------- PROSITE (2)
                PROSITE (3) ---------------------------------------------------------------TNFR_NGFR_1  PDB: C:84-123               PROSITE (3)
           Transcript 2 (1) Exon 2.3a  -------------------------------------Exon 2.5  PDB: C:69-102 [INCOMPLETE]  ----------------- Transcript 2 (1)
           Transcript 2 (2) ----------Exon 2.4  PDB: C:31-69 UniProt: 84-122 ------------------------------------Exon 2.6c          Transcript 2 (2)
                 1du3 C  21 SSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRK-------------DCTPWSDI 123
                                    30        40        50        60        70        80        90       100 |       -     | 120   
                                                                                                           102           116

Chain D from PDB  Type:PROTEIN  Length:152
 aligned with TNF10_HUMAN | P50591 from UniProtKB/Swiss-Prot  Length:281

    Alignment length:162
                                   129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279  
          TNF10_HUMAN   120 QRVAAHITGTRGRSNTLSSPNSKNEKALGRKINSWESSRSGHSFLSNLHLRNGELVIHEKGFYYIYSQTYFRFQEEIKENTKNDKQMVQYIYKYTSYPDPILLMKSARNSCWSKDAEYGLYSIYQGGIFELKENDRIFVSVTNEHLIDMDHEASFFGAFLVG 281
               SCOP domains d1du3d_ D: Apopt          osis-2 ligand, apo2l/TRAIL                                                                                                               SCOP domains
               CATH domains 1du3D00 D:120-28          1  [code=2.60.120.40, no name defined]                                                                                                   CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ...eeeee........----------...ee............eee.eee....eee...eeeeeeeeeeeee............eeeeeeeee......eeeeeeeee.........eeeeeeeeeeeee....eeeeee.hhh.ee......eeeeeee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (2) ------------------------------------------------------TNF_1            ------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE (3)
                PROSITE (4) ---TNF_2  PDB: D:123-280 UniProt: 123-280                                                                                                                        - PROSITE (4)
           Transcript 1 (1) Exon 1.5a            --------------------------------------------------------------------------------------------------------------------------------------------- Transcript 1 (1)
           Transcript 1 (2) --------------------Exon 1.7c  PDB: D:146-281 UniProt: 140-281 [INCOMPLETE]                                                                                        Transcript 1 (2)
                 1du3 D 120 QRVAAHITGTRGRSNT----------ALGRKINSWESSRSGHSFLSNLHLRNGELVIHEKGFYYIYSQTYFRFQEEIKENTKNDKQMVQYIYKYTSYPDPILLMKSARNSCWSKDAEYGLYSIYQGGIFELKENDRIFVSVTNEHLIDMDHEASFFGAFLVG 281
                                   129     |   -      |149       159       169       179       189       199       209       219       229       239       249       259       269       279  
                                         135        146

Chain E from PDB  Type:PROTEIN  Length:152
 aligned with TNF10_HUMAN | P50591 from UniProtKB/Swiss-Prot  Length:281

    Alignment length:162
                                   129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279  
          TNF10_HUMAN   120 QRVAAHITGTRGRSNTLSSPNSKNEKALGRKINSWESSRSGHSFLSNLHLRNGELVIHEKGFYYIYSQTYFRFQEEIKENTKNDKQMVQYIYKYTSYPDPILLMKSARNSCWSKDAEYGLYSIYQGGIFELKENDRIFVSVTNEHLIDMDHEASFFGAFLVG 281
               SCOP domains d1du3e_ E: Apopt          osis-2 ligand, apo2l/TRAIL                                                                                                               SCOP domains
               CATH domains 1du3E00 E:120-28          1  [code=2.60.120.40, no name defined]                                                                                                   CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ...eeeee........----------...ee............eee..ee....ee....eeeeeeeeeeeee............eeeeeeeee......eeeeeeeee.........eeeeeeeeeeeee....eeeeee.hhh.ee......eeeeee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (2) ------------------------------------------------------TNF_1            ------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE (3)
                PROSITE (4) ---TNF_2  PDB: E:123-280 UniProt: 123-280                                                                                                                        - PROSITE (4)
           Transcript 1 (1) Exon 1.5a            --------------------------------------------------------------------------------------------------------------------------------------------- Transcript 1 (1)
           Transcript 1 (2) --------------------Exon 1.7c  PDB: E:146-281 UniProt: 140-281 [INCOMPLETE]                                                                                        Transcript 1 (2)
                 1du3 E 120 QRVAAHITGTRGRSNT----------ALGRKINSWESSRSGHSFLSNLHLRNGELVIHEKGFYYIYSQTYFRFQEEIKENTKNDKQMVQYIYKYTSYPDPILLMKSARNSCWSKDAEYGLYSIYQGGIFELKENDRIFVSVTNEHLIDMDHEASFFGAFLVG 281
                                   129     |   -      |149       159       169       179       189       199       209       219       229       239       249       259       269       279  
                                         135        146

Chain F from PDB  Type:PROTEIN  Length:152
 aligned with TNF10_HUMAN | P50591 from UniProtKB/Swiss-Prot  Length:281

    Alignment length:162
                                   129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279  
          TNF10_HUMAN   120 QRVAAHITGTRGRSNTLSSPNSKNEKALGRKINSWESSRSGHSFLSNLHLRNGELVIHEKGFYYIYSQTYFRFQEEIKENTKNDKQMVQYIYKYTSYPDPILLMKSARNSCWSKDAEYGLYSIYQGGIFELKENDRIFVSVTNEHLIDMDHEASFFGAFLVG 281
               SCOP domains d1du3f_ F: Apopt          osis-2 ligand, apo2l/TRAIL                                                                                                               SCOP domains
               CATH domains 1du3F00 F:120-28          1  [code=2.60.120.40, no name defined]                                                                                                   CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ...eeeee........----------...ee............eee.eee....eee...eeeeeeeeeeeee............eeeeeeeee......eeeeeeeee.........eeeeeeeeeeeee....eeeeee.hhhh........eeeeee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (2) ------------------------------------------------------TNF_1            ------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE (3)
                PROSITE (4) ---TNF_2  PDB: F:123-280 UniProt: 123-280                                                                                                                        - PROSITE (4)
           Transcript 1 (1) Exon 1.5a            --------------------------------------------------------------------------------------------------------------------------------------------- Transcript 1 (1)
           Transcript 1 (2) --------------------Exon 1.7c  PDB: F:146-281 UniProt: 140-281 [INCOMPLETE]                                                                                        Transcript 1 (2)
                 1du3 F 120 QRVAAHITGTRGRSNT----------ALGRKINSWESSRSGHSFLSNLHLRNGELVIHEKGFYYIYSQTYFRFQEEIKENTKNDKQMVQYIYKYTSYPDPILLMKSARNSCWSKDAEYGLYSIYQGGIFELKENDRIFVSVTNEHLIDMDHEASFFGAFLVG 281
                                   129     |   -      |149       159       169       179       189       199       209       219       229       239       249       259       269       279  
                                         135        146

Chain G from PDB  Type:PROTEIN  Length:108
 aligned with TR10B_HUMAN | O14763 from UniProtKB/Swiss-Prot  Length:440

    Alignment length:108
                                    83        93       103       113       123       133       143       153       163       173        
          TR10B_HUMAN    74 SSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIECVHK 181
               SCOP domains d1du3g1 G:21-61                          d1du3g2 G:62-101                        d1du3g3 G:102-128           SCOP domains
               CATH domains 1du3G03 G:21-61                          1du3G01 G:62-101                        1du3G02 G:102-128           CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ...........eee......eee..........................eeeee........eeee...ee.........ee........eeeee........eeee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (1) ----------------------TNFR_NGFR_2  PDB: G:43-84 UniProt: 96-137 TNFR_NGFR_2  PDB: G:85-125               --- PROSITE (1)
                PROSITE (2) -----------------------TNFR_NGFR_1  PDB: G:44-84 UniProt: 97-137-------------------------------------------- PROSITE (2)
                PROSITE (3) ---------------------------------------------------------------TNFR_NGFR_1  PDB: G:84-125                --- PROSITE (3)
           Transcript 2 (1) Exon 2.3a  -------------------------------------Exon 2.5  PDB: G:69-106               ---------------------- Transcript 2 (1)
           Transcript 2 (2) ----------Exon 2.4  PDB: G:31-69 UniProt: 84-122 ------------------------------------Exon 2.6c [INCOMPLETE]  Transcript 2 (2)
                 1du3 G  21 SSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIECVHK 128
                                    30        40        50        60        70        80        90       100       110       120

Chain H from PDB  Type:PROTEIN  Length:90
 aligned with TR10B_HUMAN | O14763 from UniProtKB/Swiss-Prot  Length:440

    Alignment length:103
                                    83        93       103       113       123       133       143       153       163       173   
          TR10B_HUMAN    74 SSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDI 176
               SCOP domains d1du3h1 H:21-61                          d1du3h2 H:62-101                        d             1du3h3 H SCOP domains
               CATH domains 1du3H02 H:21-61                          1du3H01 H:62-101                        ---------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...........eee......eee.....ee..........ee.......eeeee........eeee....eee..eeeeee.-------------........ Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) ----------------------TNFR_NGFR_2  PDB: H:43-84 UniProt: 96-137 TNFR_NGFR_2  PDB: H:85-123              PROSITE (1)
                PROSITE (2) -----------------------TNFR_NGFR_1  PDB: H:44-84 UniProt: 97-137--------------------------------------- PROSITE (2)
                PROSITE (3) ---------------------------------------------------------------TNFR_NGFR_1  PDB: H:84-123               PROSITE (3)
           Transcript 2 (1) Exon 2.3a  -------------------------------------Exon 2.5  PDB: H:69-102 [INCOMPLETE]  ----------------- Transcript 2 (1)
           Transcript 2 (2) ----------Exon 2.4  PDB: H:31-69 UniProt: 84-122 ------------------------------------Exon 2.6c          Transcript 2 (2)
                 1du3 H  21 SSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRK-------------DCTPWSDI 123
                                    30        40        50        60        70        80        90       100 |       -     | 120   
                                                                                                           102           116

Chain I from PDB  Type:PROTEIN  Length:90
 aligned with TR10B_HUMAN | O14763 from UniProtKB/Swiss-Prot  Length:440

    Alignment length:103
                                    83        93       103       113       123       133       143       153       163       173   
          TR10B_HUMAN    74 SSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDI 176
               SCOP domains d1du3i1 I:21-61                          d1du3i2 I:62-101                        d             1du3i3 I SCOP domains
               CATH domains 1du3I02 I:21-61                          1du3I01 I:62-101                        ---------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...........eee......eee.....ee..........ee.......eeeee........eeee................-------------........ Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) ----------------------TNFR_NGFR_2  PDB: I:43-84 UniProt: 96-137 TNFR_NGFR_2  PDB: I:85-123              PROSITE (1)
                PROSITE (2) -----------------------TNFR_NGFR_1  PDB: I:44-84 UniProt: 97-137--------------------------------------- PROSITE (2)
                PROSITE (3) ---------------------------------------------------------------TNFR_NGFR_1  PDB: I:84-123               PROSITE (3)
           Transcript 2 (1) Exon 2.3a  -------------------------------------Exon 2.5  PDB: I:69-102 [INCOMPLETE]  ----------------- Transcript 2 (1)
           Transcript 2 (2) ----------Exon 2.4  PDB: I:31-69 UniProt: 84-122 ------------------------------------Exon 2.6c          Transcript 2 (2)
                 1du3 I  21 SSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRK-------------DCTPWSDI 123
                                    30        40        50        60        70        80        90       100 |       -     | 120   
                                                                                                           102           116

Chain J from PDB  Type:PROTEIN  Length:152
 aligned with TNF10_HUMAN | P50591 from UniProtKB/Swiss-Prot  Length:281

    Alignment length:162
                                   129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279  
          TNF10_HUMAN   120 QRVAAHITGTRGRSNTLSSPNSKNEKALGRKINSWESSRSGHSFLSNLHLRNGELVIHEKGFYYIYSQTYFRFQEEIKENTKNDKQMVQYIYKYTSYPDPILLMKSARNSCWSKDAEYGLYSIYQGGIFELKENDRIFVSVTNEHLIDMDHEASFFGAFLVG 281
               SCOP domains d1du3j_ J: Apopt          osis-2 ligand, apo2l/TRAIL                                                                                                               SCOP domains
               CATH domains 1du3J00 J:120-28          1  [code=2.60.120.40, no name defined]                                                                                                   CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ...eeeee........----------...ee............eee.eeee..eeee...eeeeeeeeeeeee............eeeeeeeee......eeeeeeeee.........eeeeeeeeeeeee....eeeeee.hhh.ee......eeeeeee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (2) ------------------------------------------------------TNF_1            ------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE (3)
                PROSITE (4) ---TNF_2  PDB: J:123-280 UniProt: 123-280                                                                                                                        - PROSITE (4)
           Transcript 1 (1) Exon 1.5a            --------------------------------------------------------------------------------------------------------------------------------------------- Transcript 1 (1)
           Transcript 1 (2) --------------------Exon 1.7c  PDB: J:146-281 UniProt: 140-281 [INCOMPLETE]                                                                                        Transcript 1 (2)
                 1du3 J 120 QRVAAHITGTRGRSNT----------ALGRKINSWESSRSGHSFLSNLHLRNGELVIHEKGFYYIYSQTYFRFQEEIKENTKNDKQMVQYIYKYTSYPDPILLMKSARNSCWSKDAEYGLYSIYQGGIFELKENDRIFVSVTNEHLIDMDHEASFFGAFLVG 281
                                   129     |   -      |149       159       169       179       189       199       209       219       229       239       249       259       269       279  
                                         135        146

Chain K from PDB  Type:PROTEIN  Length:152
 aligned with TNF10_HUMAN | P50591 from UniProtKB/Swiss-Prot  Length:281

    Alignment length:162
                                   129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279  
          TNF10_HUMAN   120 QRVAAHITGTRGRSNTLSSPNSKNEKALGRKINSWESSRSGHSFLSNLHLRNGELVIHEKGFYYIYSQTYFRFQEEIKENTKNDKQMVQYIYKYTSYPDPILLMKSARNSCWSKDAEYGLYSIYQGGIFELKENDRIFVSVTNEHLIDMDHEASFFGAFLVG 281
               SCOP domains d1du3k_ K: Apopt          osis-2 ligand, apo2l/TRAIL                                                                                                               SCOP domains
               CATH domains 1du3K00 K:120-28          1  [code=2.60.120.40, no name defined]                                                                                                   CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ...eeeee........----------...ee............eee.eee....eee...eeeeeeeeeeeee............eeeeeeeee......eeeeeeeee.........eeeeeeeeeeeee....eeeeee.hhh.ee......eeeeee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (2) ------------------------------------------------------TNF_1            ------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE (3)
                PROSITE (4) ---TNF_2  PDB: K:123-280 UniProt: 123-280                                                                                                                        - PROSITE (4)
           Transcript 1 (1) Exon 1.5a            --------------------------------------------------------------------------------------------------------------------------------------------- Transcript 1 (1)
           Transcript 1 (2) --------------------Exon 1.7c  PDB: K:146-281 UniProt: 140-281 [INCOMPLETE]                                                                                        Transcript 1 (2)
                 1du3 K 120 QRVAAHITGTRGRSNT----------ALGRKINSWESSRSGHSFLSNLHLRNGELVIHEKGFYYIYSQTYFRFQEEIKENTKNDKQMVQYIYKYTSYPDPILLMKSARNSCWSKDAEYGLYSIYQGGIFELKENDRIFVSVTNEHLIDMDHEASFFGAFLVG 281
                                   129     |   -      |149       159       169       179       189       199       209       219       229       239       249       259       269       279  
                                         135        146

Chain L from PDB  Type:PROTEIN  Length:152
 aligned with TNF10_HUMAN | P50591 from UniProtKB/Swiss-Prot  Length:281

    Alignment length:162
                                   129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279  
          TNF10_HUMAN   120 QRVAAHITGTRGRSNTLSSPNSKNEKALGRKINSWESSRSGHSFLSNLHLRNGELVIHEKGFYYIYSQTYFRFQEEIKENTKNDKQMVQYIYKYTSYPDPILLMKSARNSCWSKDAEYGLYSIYQGGIFELKENDRIFVSVTNEHLIDMDHEASFFGAFLVG 281
               SCOP domains d1du3l_ L: Apopt          osis-2 ligand, apo2l/TRAIL                                                                                                               SCOP domains
               CATH domains 1du3L00 L:120-28          1  [code=2.60.120.40, no name defined]                                                                                                   CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ...eeeee........----------...ee............eee.eee...eeee...eeeeeeeeeeeee............eeeeeeeee......eeeeeeeee.........eeeeeeeeeeeee....eeeeee.hhhh........eeeeee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (2) ------------------------------------------------------TNF_1            ------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE (3)
                PROSITE (4) ---TNF_2  PDB: L:123-280 UniProt: 123-280                                                                                                                        - PROSITE (4)
           Transcript 1 (1) Exon 1.5a            --------------------------------------------------------------------------------------------------------------------------------------------- Transcript 1 (1)
           Transcript 1 (2) --------------------Exon 1.7c  PDB: L:146-281 UniProt: 140-281 [INCOMPLETE]                                                                                        Transcript 1 (2)
                 1du3 L 120 QRVAAHITGTRGRSNT----------ALGRKINSWESSRSGHSFLSNLHLRNGELVIHEKGFYYIYSQTYFRFQEEIKENTKNDKQMVQYIYKYTSYPDPILLMKSARNSCWSKDAEYGLYSIYQGGIFELKENDRIFVSVTNEHLIDMDHEASFFGAFLVG 281
                                   129     |   -      |149       159       169       179       189       199       209       219       229       239       249       259       269       279  
                                         135        146

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit(hide GO term definitions)

Chain A,B,C,G,H,I (TR10B_HUMAN | O14763)

molecular function
	GO:0045569	TRAIL binding	Interacting selectively and non-covalently with TRAIL (TNF-related apoptosis inducing ligand), a member of the tumor necrosis factor ligand family that rapidly induces apoptosis in a variety of transformed cell lines.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0004872	receptor activity	Combining with an extracellular or intracellular messenger to initiate a change in cell activity.
	GO:0005031	tumor necrosis factor-activated receptor activity	Combining with tumor necrosis factor, a proinflammatory cytokine produced by monocytes and macrophages, to initiate a change in cell function.
biological process
	GO:0007250	activation of NF-kappaB-inducing kinase activity	The stimulation of the activity of NF-kappaB-inducing kinase through phosphorylation at specific residues.
	GO:0006919	activation of cysteine-type endopeptidase activity involved in apoptotic process	Any process that initiates the activity of the inactive enzyme cysteine-type endopeptidase in the context of an apoptotic process.
	GO:0097296	activation of cysteine-type endopeptidase activity involved in apoptotic signaling pathway	Any process that initiates the activity of an inactive cysteine-type endopeptidase involved in the apoptotic signaling pathway.
	GO:0006915	apoptotic process	A programmed cell death process which begins when a cell receives an internal (e.g. DNA damage) or external signal (e.g. an extracellular death ligand), and proceeds through a series of biochemical events (signaling pathway phase) which trigger an execution phase. The execution phase is the last step of an apoptotic process, and is typically characterized by rounding-up of the cell, retraction of pseudopodes, reduction of cellular volume (pyknosis), chromatin condensation, nuclear fragmentation (karyorrhexis), plasma membrane blebbing and fragmentation of the cell into apoptotic bodies. When the execution phase is completed, the cell has died.
	GO:0007166	cell surface receptor signaling pathway	A series of molecular signals initiated by activation of a receptor on the surface of a cell. The pathway begins with binding of an extracellular ligand to a cell surface receptor, or for receptors that signal in the absence of a ligand, by ligand-withdrawal or the activity of a constitutively active receptor. The pathway ends with regulation of a downstream cellular process, e.g. transcription.
	GO:0071260	cellular response to mechanical stimulus	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a mechanical stimulus.
	GO:0008625	extrinsic apoptotic signaling pathway via death domain receptors	A series of molecular signals in which a signal is conveyed from the cell surface to trigger the apoptotic death of a cell. The pathway starts with a ligand binding to a death domain receptor on the cell surface, and ends when the execution phase of apoptosis is triggered.
	GO:0006955	immune response	Any immune system process that functions in the calibrated response of an organism to a potential internal or invasive threat.
	GO:0006954	inflammatory response	The immediate defensive reaction (by vertebrate tissue) to infection or injury caused by chemical or physical agents. The process is characterized by local vasodilation, extravasation of plasma into intercellular spaces and accumulation of white blood cells and macrophages.
	GO:0070059	intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress	A series of molecular signals in which an intracellular signal is conveyed to trigger the apoptotic death of a cell. The pathway is induced in response to a stimulus indicating endoplasmic reticulum (ER) stress, and ends when the execution phase of apoptosis is triggered. ER stress usually results from the accumulation of unfolded or misfolded proteins in the ER lumen.
	GO:0007275	multicellular organism development	The biological process whose specific outcome is the progression of a multicellular organism over time from an initial condition (e.g. a zygote or a young adult) to a later condition (e.g. a multicellular animal or an aged adult).
	GO:1902042	negative regulation of extrinsic apoptotic signaling pathway via death domain receptors	Any process that stops, prevents or reduces the frequency, rate or extent of extrinsic apoptotic signaling pathway via death domain receptors.
	GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	Any process that activates or increases the frequency, rate or extent of I-kappaB kinase/NF-kappaB signaling.
	GO:0042981	regulation of apoptotic process	Any process that modulates the occurrence or rate of cell death by apoptotic process.
	GO:0042127	regulation of cell proliferation	Any process that modulates the frequency, rate or extent of cell proliferation.
	GO:1902041	regulation of extrinsic apoptotic signaling pathway via death domain receptors	Any process that modulates the frequency, rate or extent of extrinsic apoptotic signaling pathway via death domain receptors.
	GO:0034976	response to endoplasmic reticulum stress	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stress acting at the endoplasmic reticulum. ER stress usually results from the accumulation of unfolded or misfolded proteins in the ER lumen.
	GO:0032496	response to lipopolysaccharide	Any process that results in a change in state or activity of an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a lipopolysaccharide stimulus; lipopolysaccharide is a major component of the cell wall of gram-negative bacteria.
	GO:0007165	signal transduction	The cellular process in which a signal is conveyed to trigger a change in the activity or state of a cell. Signal transduction begins with reception of a signal (e.g. a ligand binding to a receptor or receptor activation by a stimulus such as light), or for signal transduction in the absence of ligand, signal-withdrawal or the activity of a constitutively active receptor. Signal transduction ends with regulation of a downstream cellular process, e.g. regulation of transcription or regulation of a metabolic process. Signal transduction covers signaling from receptors located on the surface of the cell and signaling via molecules located within the cell. For signaling between cells, signal transduction is restricted to events at and within the receiving cell.
	GO:0033209	tumor necrosis factor-mediated signaling pathway	A series of molecular signals initiated by the binding of a tumor necrosis factor to a receptor on the surface of a cell, and ending with regulation of a downstream cellular process, e.g. transcription.
cellular component
	GO:0009986	cell surface	The external part of the cell wall and/or plasma membrane.
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0005887	integral component of plasma membrane	The component of the plasma membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0005622	intracellular	The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

Chain D,E,F,J,K,L (TNF10_HUMAN | P50591)

molecular function
	GO:0005125	cytokine activity	Functions to control the survival, growth, differentiation and effector function of tissues and cells.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0005102	receptor binding	Interacting selectively and non-covalently with one or more specific sites on a receptor molecule, a macromolecule that undergoes combination with a hormone, neurotransmitter, drug or intracellular messenger to initiate a change in cell function.
	GO:0005164	tumor necrosis factor receptor binding	Interacting selectively and non-covalently with the tumor necrosis factor receptor.
	GO:0032813	tumor necrosis factor receptor superfamily binding	Interacting selectively and non-covalently with any member of the tumor necrosis factor receptor superfamily.
biological process
	GO:0006919	activation of cysteine-type endopeptidase activity involved in apoptotic process	Any process that initiates the activity of the inactive enzyme cysteine-type endopeptidase in the context of an apoptotic process.
	GO:0097296	activation of cysteine-type endopeptidase activity involved in apoptotic signaling pathway	Any process that initiates the activity of an inactive cysteine-type endopeptidase involved in the apoptotic signaling pathway.
	GO:0006915	apoptotic process	A programmed cell death process which begins when a cell receives an internal (e.g. DNA damage) or external signal (e.g. an extracellular death ligand), and proceeds through a series of biochemical events (signaling pathway phase) which trigger an execution phase. The execution phase is the last step of an apoptotic process, and is typically characterized by rounding-up of the cell, retraction of pseudopodes, reduction of cellular volume (pyknosis), chromatin condensation, nuclear fragmentation (karyorrhexis), plasma membrane blebbing and fragmentation of the cell into apoptotic bodies. When the execution phase is completed, the cell has died.
	GO:0007166	cell surface receptor signaling pathway	A series of molecular signals initiated by activation of a receptor on the surface of a cell. The pathway begins with binding of an extracellular ligand to a cell surface receptor, or for receptors that signal in the absence of a ligand, by ligand-withdrawal or the activity of a constitutively active receptor. The pathway ends with regulation of a downstream cellular process, e.g. transcription.
	GO:0007267	cell-cell signaling	Any process that mediates the transfer of information from one cell to another. This process includes signal transduction in the receiving cell and, where applicable, release of a ligand and any processes that actively facilitate its transport and presentation to the receiving cell. Examples include signaling via soluble ligands, via cell adhesion molecules and via gap junctions.
	GO:0006955	immune response	Any immune system process that functions in the calibrated response of an organism to a potential internal or invasive threat.
	GO:1902042	negative regulation of extrinsic apoptotic signaling pathway via death domain receptors	Any process that stops, prevents or reduces the frequency, rate or extent of extrinsic apoptotic signaling pathway via death domain receptors.
	GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	Any process that activates or increases the frequency, rate or extent of I-kappaB kinase/NF-kappaB signaling.
	GO:0043065	positive regulation of apoptotic process	Any process that activates or increases the frequency, rate or extent of cell death by apoptotic process.
	GO:0043280	positive regulation of cysteine-type endopeptidase activity involved in apoptotic process	Any process that activates or increases the activity of a cysteine-type endopeptidase involved in the apoptotic process.
	GO:2001238	positive regulation of extrinsic apoptotic signaling pathway	Any process that activates or increases the frequency, rate or extent of extrinsic apoptotic signaling pathway.
	GO:0090200	positive regulation of release of cytochrome c from mitochondria	Any process that increases the rate, frequency or extent of release of cytochrome c from mitochondria, the process in which cytochrome c is enabled to move from the mitochondrial intermembrane space into the cytosol, which is an early step in apoptosis and leads to caspase activation.
	GO:1902041	regulation of extrinsic apoptotic signaling pathway via death domain receptors	Any process that modulates the frequency, rate or extent of extrinsic apoptotic signaling pathway via death domain receptors.
	GO:0007165	signal transduction	The cellular process in which a signal is conveyed to trigger a change in the activity or state of a cell. Signal transduction begins with reception of a signal (e.g. a ligand binding to a receptor or receptor activation by a stimulus such as light), or for signal transduction in the absence of ligand, signal-withdrawal or the activity of a constitutively active receptor. Signal transduction ends with regulation of a downstream cellular process, e.g. regulation of transcription or regulation of a metabolic process. Signal transduction covers signaling from receptors located on the surface of the cell and signaling via molecules located within the cell. For signaling between cells, signal transduction is restricted to events at and within the receiving cell.
cellular component
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
	GO:0005576	extracellular region	The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
	GO:0005615	extracellular space	That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0005887	integral component of plasma membrane	The component of the plasma membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 2)

Sites (2, 2)

SS Bonds (36, 36)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (4, 36)

Exons (6, 36)

Sequences/Alignments

Classification and Annotation

SCOP Domains (2, 24)

CATH Domains (2, 20)

Pfam Domains (0, 0)

Gene Ontology (43, 56)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File