|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
(no "Ligand,Modified Residues,Ions" information available for 1DHM) |
(no "Site" information available for 1DHM) |
(no "SS Bond" information available for 1DHM) |
(no "Cis Peptide Bond" information available for 1DHM) |
(no "SAP(SNP)/Variant" information available for 1DHM) |
(no "PROSITE Motif" information available for 1DHM) |
(no "Exon" information available for 1DHM) |
NMR StructureChain A from PDB Type:PROTEIN Length:83 aligned with VE2_HPV31 | P17383 from UniProtKB/Swiss-Prot Length:372 Alignment length:83 299 309 319 329 339 349 359 369 VE2_HPV31 290 PATTPIIHLKGDANILKCLRYRLSKYKQLYEQVSSTWHWTCTDGKHKNAIVTLTYISTSQRDDFLNTVKIPNTVSVSTGYMTI 372 SCOP domains d1dhma_ A: Papillomavirus-1 E2 protein SCOP domains CATH domains 1dhmA00 A:1-83 [code=3.30.70.330, no name defined] CATH domains Pfam domains ----------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------------------------------- PROSITE Transcript ----------------------------------------------------------------------------------- Transcript 1dhm A 1 MATTPIIHLKGDANILKCLRYRLSKYKQLYEQVSSTWHWTCTDGKHKNAIVTLTYISTSQRDDFLNTVKIPNTVSVSTGYMTI 83 10 20 30 40 50 60 70 80 Chain B from PDB Type:PROTEIN Length:83 aligned with VE2_HPV31 | P17383 from UniProtKB/Swiss-Prot Length:372 Alignment length:83 299 309 319 329 339 349 359 369 VE2_HPV31 290 PATTPIIHLKGDANILKCLRYRLSKYKQLYEQVSSTWHWTCTDGKHKNAIVTLTYISTSQRDDFLNTVKIPNTVSVSTGYMTI 372 SCOP domains d1dhmb_ B: Papillomavirus-1 E2 protein SCOP domains CATH domains 1dhmB00 B:1-83 [code=3.30.70.330, no name defined] CATH domains Pfam domains ----------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------------------------------- PROSITE Transcript ----------------------------------------------------------------------------------- Transcript 1dhm B 1 MATTPIIHLKGDANILKCLRYRLSKYKQLYEQVSSTWHWTCTDGKHKNAIVTLTYISTSQRDDFLNTVKIPNTVSVSTGYMTI 83 10 20 30 40 50 60 70 80
|
NMR Structure |
NMR Structure |
(no "Pfam Domain" information available for 1DHM) |
NMR Structure(hide GO term definitions) Chain A,B (VE2_HPV31 | P17383)
|
|
|
|
|
|
|