Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)

(-) Description

Title :  CYTOCHROME C OF CLASS III (AMBLER) 26 KD
 
Authors :  M. Czjzek, R. Haser
Date :  12 Jan 96  (Deposition) - 11 Jul 96  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.16
Chains :  Asym. Unit :  A
Biol. Unit 1:  A  (2x)
Keywords :  Octaheme Cytochrome, Electron Transport (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  M. Czjzek, F. Guerlesquin, M. Bruschi, R. Haser
Crystal Structure Of A Dimeric Octaheme Cytochrome C3 (M(R) 26, 000) From Desulfovibrio Desulfuricans Norway.
Structure V. 4 395 1996
PubMed-ID: 8740362  |  Reference-DOI: 10.1016/S0969-2126(96)00045-7
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - CYTOCHROME C3
    Chains: A
    Organism Scientific: DESULFOMICROBIUM NORVEGICUM
    Organism Taxid: 52561
    Other Details: SULFATE REDUCING BACTERIA
    Strain: NORWAY 4

 Structural Features

(-) Chains, Units

  1
Asymmetric Unit : A
Biological Unit 1 (2x): A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 5)

Asymmetric Unit (2, 5)
No.NameCountTypeFull Name
1HEM4Ligand/IonPROTOPORPHYRIN IX CONTAINING FE
2SO41Ligand/IonSULFATE ION
Biological Unit 1 (2, 10)
No.NameCountTypeFull Name
1HEM8Ligand/IonPROTOPORPHYRIN IX CONTAINING FE
2SO42Ligand/IonSULFATE ION

(-) Sites  (5, 5)

Asymmetric Unit (5, 5)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREPRO A:6 , GLU A:7 , SER A:8 , ARG A:91 , ARG A:95BINDING SITE FOR RESIDUE SO4 A 200
2AC2SOFTWARETHR A:2 , PHE A:3 , VAL A:9 , PHE A:28 , HIS A:30 , HIS A:33 , ILE A:36 , CYS A:38 , CYS A:41 , HIS A:42 , ILE A:51 , SER A:53 , CYS A:54 , HEM A:121BINDING SITE FOR RESIDUE HEM A 119
3AC3SOFTWARECYS A:41 , HIS A:43 , THR A:44 , GLU A:52 , SER A:53 , CYS A:54 , CYS A:59 , HIS A:60 , ARG A:74 , THR A:75 , PHE A:76 , LYS A:84BINDING SITE FOR RESIDUE HEM A 120
4AC4SOFTWAREVAL A:26 , PHE A:28 , ASN A:29 , SER A:32 , HIS A:33 , GLN A:40 , GLU A:83 , SER A:85 , CYS A:86 , CYS A:89 , HIS A:90 , LEU A:93 , ASP A:100 , PRO A:102 , CYS A:105 , ASN A:106 , HEM A:119 , HOH A:201 , HOH A:227BINDING SITE FOR RESIDUE HEM A 121
5AC5SOFTWAREMET A:11 , PRO A:13 , TYR A:19 , PRO A:21 , LYS A:22 , LYS A:23 , VAL A:26 , ASN A:29 , PHE A:76 , HIS A:77 , CYS A:86 , HIS A:90 , LEU A:103 , ALA A:104 , CYS A:105 , CYS A:108 , HIS A:109 , HOH A:216BINDING SITE FOR RESIDUE HEM A 122

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1CZJ)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1CZJ)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1CZJ)

(-) PROSITE Motifs  (1, 1)

Asymmetric Unit (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1MULTIHEME_CYTCPS51008 Multiheme cytochrome c family profile.CYC32_DESNO33-95  1A:33-95
Biological Unit 1 (1, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1MULTIHEME_CYTCPS51008 Multiheme cytochrome c family profile.CYC32_DESNO33-95  2A:33-95

(-) Exons   (0, 0)

(no "Exon" information available for 1CZJ)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:110
 aligned with CYC32_DESNO | P38554 from UniProtKB/Swiss-Prot  Length:111

    Alignment length:110
                                    11        21        31        41        51        61        71        81        91       101       111
          CYC32_DESNO     2 TFEIPESVTMSPKQFEGYTPKKGDVTFNHASHMDIACQQCHHTVPDTYTIESCMTEGCHDNIKERTEISSVYRTFHTTKDSEKSCVGCHRELKRQGPSDAPLACNSCHVQ 111
               SCOP domains d1czja_ A: Cytochrome c3                                                                                       SCOP domains
               CATH domains 1czjA00 A:2-111 Cytochrome C3                                                                                  CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......eeee..............eeee.hhh....hhhh...hhhh.......................hhhhhh........hhhhhhhhhhh........hhhh... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------MULTIHEME_CYTC  PDB: A:33-95 UniProt: 33-95                    ---------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------- Transcript
                 1czj A   2 TFEIPESVTMSPKQFEGYTPKKGDVTFNHASHMDIACQQCHHTVPDTYTIESCMTEGCHDNIKERTEISSVYRTFHTTKDSEKSCVGCHRELKRQGPSDAPLACNSCHVQ 111
                                    11        21        31        41        51        61        71        81        91       101       111
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

Asymmetric Unit
(-)
Class: All alpha proteins (14657)

(-) CATH Domains  (1, 1)

Asymmetric Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1CZJ)

(-) Gene Ontology  (6, 6)

Asymmetric Unit(hide GO term definitions)
Chain A   (CYC32_DESNO | P38554)
molecular function
    GO:0009055    electron carrier activity    Any molecular entity that serves as an electron acceptor and electron donor in an electron transport chain. An electron transport chain is a process in which a series of electron carriers operate together to transfer electrons from donors to any of several different terminal electron acceptors to generate a transmembrane electrochemical gradient.
    GO:0020037    heme binding    Interacting selectively and non-covalently with heme, any compound of iron complexed in a porphyrin (tetrapyrrole) ring.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
biological process
    GO:0009061    anaerobic respiration    The enzymatic release of energy from inorganic and organic compounds (especially carbohydrates and fats) which uses compounds other than oxygen (e.g. nitrate, sulfate) as the terminal electron acceptor.
    GO:0055114    oxidation-reduction process    A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
cellular component
    GO:0042597    periplasmic space    The region between the inner (cytoplasmic) and outer membrane (Gram-negative Bacteria) or cytoplasmic membrane and cell wall (Fungi and Gram-positive Bacteria).

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    HEM  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    SO4  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1czj)
 
Biological Unit
  Complete Structure
    Biological Unit 1  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Asym. Unit - sites PNG format | Biol. Unit 1 PNG format | Biol. Unit 1 - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1czj
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  CYC32_DESNO | P38554
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  CYC32_DESNO | P38554
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        CYC32_DESNO | P38554: 1aqe

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1CZJ)