Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  YEAST RIBOSOMAL PROTEIN L30
 
Authors :  H. Mao, J. R. Willamson
Date :  26 May 99  (Deposition) - 14 Oct 99  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (20x)
Keywords :  Nmr, Ribosomal Protein, Auto-Regulation Of Pre-Mrna Splicing And Mrna Translation, Ribosome (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  H. Mao, J. R. Williamson
Local Folding Coupled To Rna Binding In The Yeast Ribosomal Protein L30.
J. Mol. Biol. V. 292 345 1999
PubMed-ID: 10493880  |  Reference-DOI: 10.1006/JMBI.1999.3044
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - 60S RIBOSOMAL PROTEIN L30E
    Cellular LocationCYTOPLASM
    ChainsA
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Cellular LocationCYTOPLASM
    Expression System GeneL30
    Expression System PlasmidPMALC-L30
    Expression System StrainJM109
    Expression System Taxid562
    GeneRPL30
    OrganelleRIBOSOME,60S SUBUNIT
    Organism CommonBAKER'S YEAST
    Organism ScientificSACCHAROMYCES CEREVISIAE
    Organism Taxid4932
    Other DetailsRECOMBINANT EXPRESSION AS A C-TERMINAL MALTOSE-BINDING PROTEIN FUSION IN ESCHERICHIA COLI STRAIN JM109 HOSTING PLASMID PMALC-30
    SynonymYL32, RP73

 Structural Features

(-) Chains, Units

  
NMR Structure (20x)

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1CN7)

(-) Sites  (0, 0)

(no "Site" information available for 1CN7)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1CN7)

(-) Cis Peptide Bonds  (8, 11)

NMR Structure
No.ModelResidues
12Val A:4 -Lys A:5
22Gly A:73 -Asn A:74
33Lys A:5 -Ser A:6
44Arg A:86 -Val A:87
511, 20Gly A:72 -Gly A:73
612, 17Asp A:97 -Ser A:98
717, 20Leu A:104 -Ala A:105
820Val A:87 -Gly A:88

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1CN7)

(-) PROSITE Motifs  (2, 2)

NMR Structure (2, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1RIBOSOMAL_L30E_1PS00709 Ribosomal protein L30e signature 1.RL30_YEAST20-44  1A:20-44
2RIBOSOMAL_L30E_2PS00993 Ribosomal protein L30e signature 2.RL30_YEAST76-96  1A:76-96

(-) Exons   (1, 1)

NMR Structure (1, 1)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1YGL030W1YGL030W.1VII:439096-4390983RL30_YEAST1-110--
1.2YGL030W2YGL030W.2VII:439329-439643315RL30_YEAST2-1051041A:2-105104

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:104
 aligned with RL30_YEAST | P14120 from UniProtKB/Swiss-Prot  Length:105

    Alignment length:104
                                    11        21        31        41        51        61        71        81        91       101    
           RL30_YEAST     2 APVKSQESINQKLALVIKSGKYTLGYKSTVKSLRQGKSKLIIIAANTPVLRKSELEYYAMLSKTKVYYFQGGNNELGTAVGKLFRVGVVSILEAGDSDILTTLA 105
               SCOP domains d1cn7a_ A: Eukaryotic ribosomal protein L30 (L30e)                                                       SCOP domains
               CATH domains 1cn7A00 A:2-105  [code=3.30.1330.30, no name defined]                                                    CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....hhhhhhhhhhhhh....eee.hhhhhhhhh.....eeeee....hhhhhhhhhhhhh...eeee......hhhhhh.hhh..eeeee.......hhhh.. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------RIBOSOMAL_L30E_1         -------------------------------RIBOSOMAL_L30E_2     --------- PROSITE
               Transcript 1 Exon 1.2  PDB: A:2-105 UniProt: 2-105                                                                    Transcript 1
                 1cn7 A   2 APVKSQESINQKLALVIKSGKYTLGYKSTVKSLRQGKSKLIIIAANTPVLRKSELEYYAMLSKTKVYYFQGGNNELGTAVGKLFRVGVVSILEAGDSDILTTLA 105
                                    11        21        31        41        51        61        71        81        91       101    

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

NMR Structure

(-) CATH Domains  (1, 1)

NMR Structure
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1CN7)

(-) Gene Ontology  (12, 12)

NMR Structure(hide GO term definitions)
Chain A   (RL30_YEAST | P14120)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0030627    pre-mRNA 5'-splice site binding    Interacting selectively and non-covalently with the pre-mRNA 5' splice site sequence.
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0002181    cytoplasmic translation    The chemical reactions and pathways resulting in the formation of a protein in the cytoplasm. This is a ribosome-mediated process in which the information in messenger RNA (mRNA) is used to specify the sequence of amino acids in the protein.
    GO:0048025    negative regulation of mRNA splicing, via spliceosome    Any process that stops, prevents or reduces the rate or extent of mRNA splicing via a spliceosomal mechanism.
    GO:0006364    rRNA processing    Any process involved in the conversion of a primary ribosomal RNA (rRNA) transcript into one or more mature rRNA molecules.
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0022625    cytosolic large ribosomal subunit    The large subunit of a ribosome located in the cytosol.
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1cn7)
 
  Sites
(no "Sites" information available for 1cn7)
 
  Cis Peptide Bonds
    Arg A:86 - Val A:87   [ RasMol ]  
    Asp A:97 - Ser A:98   [ RasMol ]  
    Gly A:72 - Gly A:73   [ RasMol ]  
    Gly A:73 - Asn A:74   [ RasMol ]  
    Leu A:104 - Ala A:105   [ RasMol ]  
    Lys A:5 - Ser A:6   [ RasMol ]  
    Val A:4 - Lys A:5   [ RasMol ]  
    Val A:87 - Gly A:88   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1cn7
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  RL30_YEAST | P14120
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  RL30_YEAST | P14120
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        RL30_YEAST | P141201ck2 1nmu 1t0k 3j6x 3j6y 3j77 3j78 3jct 4u3m 4u3n 4u3u 4u4n 4u4o 4u4q 4u4r 4u4u 4u4y 4u4z 4u50 4u51 4u52 4u53 4u55 4u56 4u6f 4v6i 4v7f 4v7r 4v88 4v8t 4v8y 4v8z 4v91 5apn 5apo 5dat 5dc3 5dge 5dgf 5dgv 5fci 5fcj 5fl8 5gak 5h4p 5i4l 5jcs 5juo 5jup 5jus 5jut 5juu 5lyb 5m1j 5mc6 5t62 5t6r 5tga 5tgm

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1CN7)