![]() |
|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric Unit (1, 3)
|
Asymmetric Unit (3, 3)
|
(no "SS Bond" information available for 1CKS) |
(no "Cis Peptide Bond" information available for 1CKS) |
(no "SAP(SNP)/Variant" information available for 1CKS) |
Asymmetric Unit (2, 6)
|
Asymmetric Unit (3, 9)
|
Asymmetric UnitChain A from PDB Type:PROTEIN Length:74 aligned with CKS2_HUMAN | P33552 from UniProtKB/Swiss-Prot Length:79 Alignment length:74 11 21 31 41 51 61 71 CKS2_HUMAN 2 AHKQIYYSDKYFDEHYEYRHVMLPRELSKQVPKTHLMSEEEWRRLGVQQSLGWVHYMIHEPEPHILLFRRPLPK 75 SCOP domains d1cksa_ A: CksHs2 SCOP domains CATH domains 1cksA00 A:2-75 Cyclin-Dependent Kinase Subunit Type 2 CATH domains Pfam domains -------------------------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------------------------- SAPs(SNPs) PROSITE ------CKS_1 PDB: A:8-26 ---------------------------------CKS_2 ----- PROSITE Transcript 1 (1) Exon 1.1 ------------------------------------------Exon 1.3 Transcript 1 (1) Transcript 1 (2) ------------------Exon 1.2 PDB: A:20-63 UniProt: 20-63 ------------ Transcript 1 (2) 1cks A 2 AHKQIYYSDKYFDEHYEYRHVMLPRELSKQVPKTHLMSEEEWRRLGVQQSLGWVHYMIHEPEPHILLFRRPLPK 75 11 21 31 41 51 61 71 Chain B from PDB Type:PROTEIN Length:78 aligned with CKS2_HUMAN | P33552 from UniProtKB/Swiss-Prot Length:79 Alignment length:78 11 21 31 41 51 61 71 CKS2_HUMAN 2 AHKQIYYSDKYFDEHYEYRHVMLPRELSKQVPKTHLMSEEEWRRLGVQQSLGWVHYMIHEPEPHILLFRRPLPKDQQK 79 SCOP domains d1cksb_ B: CksHs2 SCOP domains CATH domains 1cksB00 B:2-79 Cyclin-Dependent Kinase Subunit Type 2 CATH domains Pfam domains ------------------------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------ SAPs(SNPs) PROSITE ------CKS_1 PDB: B:8-26 ---------------------------------CKS_2 --------- PROSITE Transcript 1 (1) Exon 1.1 ------------------------------------------Exon 1.3 Transcript 1 (1) Transcript 1 (2) ------------------Exon 1.2 PDB: B:20-63 UniProt: 20-63 ---------------- Transcript 1 (2) 1cks B 2 AHKQIYYSDKYFDEHYEYRHVMLPRELSKQVPKTHLMSEEEWRRLGVQQSLGWVHYMIHEPEPHILLFRRPLPKDQQK 79 11 21 31 41 51 61 71 Chain C from PDB Type:PROTEIN Length:78 aligned with CKS2_HUMAN | P33552 from UniProtKB/Swiss-Prot Length:79 Alignment length:78 11 21 31 41 51 61 71 CKS2_HUMAN 2 AHKQIYYSDKYFDEHYEYRHVMLPRELSKQVPKTHLMSEEEWRRLGVQQSLGWVHYMIHEPEPHILLFRRPLPKDQQK 79 SCOP domains d1cksc_ C: CksHs2 SCOP domains CATH domains 1cksC00 C:2-79 Cyclin-Dependent Kinase Subunit Type 2 CATH domains Pfam domains ------------------------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------ SAPs(SNPs) PROSITE ------CKS_1 PDB: C:8-26 ---------------------------------CKS_2 --------- PROSITE Transcript 1 (1) Exon 1.1 ------------------------------------------Exon 1.3 Transcript 1 (1) Transcript 1 (2) ------------------Exon 1.2 PDB: C:20-63 UniProt: 20-63 ---------------- Transcript 1 (2) 1cks C 2 AHKQIYYSDKYFDEHYEYRHVMLPRELSKQVPKTHLMSEEEWRRLGVQQSLGWVHYMIHEPEPHILLFRRPLPKDQQK 79 11 21 31 41 51 61 71
|
Asymmetric Unit |
Asymmetric Unit |
(no "Pfam Domain" information available for 1CKS) |
Asymmetric Unit(hide GO term definitions) Chain A,B,C (CKS2_HUMAN | P33552)
|
|
|
|
|
|
|