Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  THREE-DIMENSIONAL SOLUTION STRUCTURE OF CA2+-LOADED PORCINE CALBINDIN D9K DETERMINED BY NUCLEAR MAGNETIC RESONANCE SPECTROSCOPY
 
Authors :  M. Akke, T. Drakenberg, W. J. Chazin
Date :  13 Dec 91  (Deposition) - 31 Oct 93  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (13x)
Keywords :  Calcium-Binding Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  M. Akke, T. Drakenberg, W. J. Chazin
Three-Dimensional Solution Structure Of Ca(2+)-Loaded Porcine Calbindin D9K Determined By Nuclear Magnetic Resonance Spectroscopy.
Biochemistry V. 31 1011 1992
PubMed-ID: 1734952  |  Reference-DOI: 10.1021/BI00119A009
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - CALBINDIN D9K
    ChainsA
    EngineeredYES
    Organism CommonPIG
    Organism ScientificSUS SCROFA
    Organism Taxid9823

 Structural Features

(-) Chains, Units

  
NMR Structure (13x)

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1CB1)

(-) Sites  (0, 0)

(no "Site" information available for 1CB1)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1CB1)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1CB1)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1CB1)

(-) PROSITE Motifs  (3, 3)

NMR Structure (3, 3)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1EF_HAND_2PS50222 EF-hand calcium-binding domain profile.S100G_PIG45-79  1A:41-75
2S100_CABPPS00303 S-100/ICaBP type calcium binding protein signature.S100G_PIG53-74  1A:49-70
3EF_HAND_1PS00018 EF-hand calcium-binding domain.S100G_PIG58-70  1A:54-66

(-) Exons   (0, 0)

(no "Exon" information available for 1CB1)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:78
 aligned with S100G_PIG | P02632 from UniProtKB/Swiss-Prot  Length:79

    Alignment length:78
                                    11        21        31        41        51        61        71        
             S100G_PIG    2 SAQKSPAELKSIFEKYAAKEGDPNQLSKEELKQLIQAEFPSLLKGPRTLDDLFQELDKNGDGEVSFEEFQVLVKKISQ 79
               SCOP domains d1cb1a_ A: Calbindin D9K                                                       SCOP domains
               CATH domains 1cb1A00 A:-2-75 EF-hand                                                        CATH domains
               Pfam domains ------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ....hhhhhhhhhhhhhh......eehhhhhhhhhhhhh..........hhhhhhh.......eehhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (1) -------------------------------------------EF_HAND_2  PDB: A:41-75             PROSITE (1)
                PROSITE (2) ---------------------------------------------------S100_CABP  PDB: A:49-7----- PROSITE (2)
                PROSITE (3) --------------------------------------------------------EF_HAND_1    --------- PROSITE (3)
                 Transcript ------------------------------------------------------------------------------ Transcript
                  1cb1 A -2 SAQKSPAELKSIFEKYAAKEGDPNQLSKEELKQLIQAEFPSLLKGPRTLDDLFQELDKNGDGEVSFEEFQVLVKKISQ 75
                                     7        17        27        37        47        57        67        

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

NMR Structure

(-) CATH Domains  (1, 1)

NMR Structure

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1CB1)

(-) Gene Ontology  (3, 3)

NMR Structure(hide GO term definitions)
Chain A   (S100G_PIG | P02632)
molecular function
    GO:0005509    calcium ion binding    Interacting selectively and non-covalently with calcium ions (Ca2+).
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0005499    vitamin D binding    Interacting selectively and non-covalently with vitamin D, any of a group of related, fat-soluble compounds that are derived from delta-5,7 steroids and play a central role in calcium metabolism. Specific forms of vitamin D include calciferol (ergocalciferol; vitamin D2) and cholecalciferol (calciol; vitamin D3).

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1cb1)
 
  Sites
(no "Sites" information available for 1cb1)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1cb1)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1cb1
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  S100G_PIG | P02632
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  S100G_PIG | P02632
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        S100G_PIG | P026321rsw 1rsx

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1CB1)