Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  THP12-CARRIER PROTEIN FROM YELLOW MEAL WORM
 
Authors :  F. D. Soennichsen
Date :  10 Jul 99  (Deposition) - 10 Nov 99  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A
Keywords :  Ef-Hand, All-Alpha, Antifreeze Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  S. Rothemund, Y. C. Liou, P. L. Davies, E. Krause, F. D. Sonnichsen
A New Class Of Hexahelical Insect Proteins Revealed As Putative Carriers Of Small Hydrophobic Ligands.
Structure Fold. Des. V. 7 1325 1999
PubMed-ID: 10574794  |  Reference-DOI: 10.1016/S0969-2126(00)80022-2
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - THP12 CARRIER PROTEIN
    ChainsA
    EngineeredYES
    Expression SystemESCHERICHIA COLI BL21(DE3)
    Expression System PlasmidPET20B
    Expression System StrainBL21(DE3)
    Expression System Taxid469008
    Organism CommonYELLOW MEALWORM
    Organism ScientificTENEBRIO MOLITOR
    Organism Taxid7067
    Other DetailsTHIS SEQUENCE OCCURS NATURALLY IN YELLOW MEAL WORM

 Structural Features

(-) Chains, Units

  
NMR Structure 

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1C3Z)

(-) Sites  (0, 0)

(no "Site" information available for 1C3Z)

(-) SS Bonds  (2, 2)

NMR Structure
No.Residues
1A:14 -A:45
2A:85 -A:102

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1C3Z)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1C3Z)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1C3Z)

(-) Exons   (0, 0)

(no "Exon" information available for 1C3Z)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:108
 aligned with Q27011_TENMO | Q27011 from UniProtKB/TrEMBL  Length:126

    Alignment length:108
                                    28        38        48        58        68        78        88        98       108       118        
         Q27011_TENMO    19 ETPREKLKQHSDACKAESGVSEESLNKVRNREEVDDPKLKEHAFCILKRAGFIDASGEFQLDHIKTKFKENSEHPEKVDDLVAKCAVKKDTPQHSSADFFKCVHDNRS 126
               SCOP domains d1c3za_ A: Thp12-carrier protein                                                                             SCOP domains
               CATH domains 1c3zA00 A:1-108  [code=1.10.238.20, no name defined]                                                         CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ............hhhhh.....hhhhhh.......hhhhhhhhhhhhhhhh........hhhhhhhhhhh......hhhhhhhhhh....hhhhhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------ Transcript
                 1c3z A   1 ETPREKLKQHSDACKAESGVSEESLNKVRNREEVDDPKLKEHAFCILKRAGFIDASGEFQLDHIKTKFKENSEHPEKVDDLVAKCAVKKDTPQHSSADFFKCVHDNRS 108
                                    10        20        30        40        50        60        70        80        90       100        

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

NMR Structure

(-) CATH Domains  (1, 1)

NMR Structure

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1C3Z)

(-) Gene Ontology  (1, 1)

NMR Structure(hide GO term definitions)
Chain A   (Q27011_TENMO | Q27011)
molecular function
    GO:0005549    odorant binding    Interacting selectively and non-covalently with an odorant, any substance capable of stimulating the sense of smell.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1c3z)
 
  Sites
(no "Sites" information available for 1c3z)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1c3z)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1c3z
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q27011_TENMO | Q27011
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  Q27011_TENMO | Q27011
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        Q27011_TENMO | Q270111c3y

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1C3Z)