Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  BACTERIOPHAGE T4 GENE 59 HELICASE ASSEMBLY PROTEIN
 
Authors :  T. C. Mueser, C. E. Jones, N. G. Nossal, C. C. Hyde
Date :  22 Jul 99  (Deposition) - 16 Feb 00  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.45
Chains :  Asym./Biol. Unit :  A
Keywords :  Helicase Assembly, Dna Replication, Dna Recombination, Forked Dna, Dna Binding Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  T. C. Mueser, C. E. Jones, N. G. Nossal, C. C. Hyde
Bacteriophage T4 Gene 59 Helicase Assembly Protein Binds Replication Fork Dna. The 1. 45 A Resolution Crystal Structure Reveals A Novel Alpha-Helical Two-Domain Fold.
J. Mol. Biol. V. 296 597 2000
PubMed-ID: 10669611  |  Reference-DOI: 10.1006/JMBI.1999.3438
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - BPT4 GENE 59 HELICASE ASSEMBLY PROTEIN
    ChainsA
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPVEX11 (T7 PROMOTER)
    Expression System Taxid562
    Expression System Vector TypePLASMID
    Organism ScientificENTEROBACTERIA PHAGE T4
    Organism Taxid10665

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 14)

Asymmetric/Biological Unit (2, 14)
No.NameCountTypeFull Name
1CL12Ligand/IonCHLORIDE ION
2IR2Ligand/IonIRIDIUM ION

(-) Sites  (14, 14)

Asymmetric Unit (14, 14)
No.NameEvidenceResiduesDescription
01AC1SOFTWARECL A:2222 , CL A:2223 , CL A:2224 , CL A:2225 , CL A:2226 , CL A:2227BINDING SITE FOR RESIDUE IR A 2221
02AC2SOFTWAREIR A:2221 , CL A:2223 , CL A:2224 , CL A:2225 , CL A:2226 , CL A:2227BINDING SITE FOR RESIDUE CL A 2222
03AC3SOFTWAREMET A:1 , LYS A:203 , IR A:2221 , CL A:2222 , CL A:2224 , CL A:2227BINDING SITE FOR RESIDUE CL A 2223
04AC4SOFTWARELYS A:203 , IR A:2221 , CL A:2222 , CL A:2223 , CL A:2225 , CL A:2227BINDING SITE FOR RESIDUE CL A 2224
05AC5SOFTWAREIR A:2221 , CL A:2222 , CL A:2224 , CL A:2226 , CL A:2227BINDING SITE FOR RESIDUE CL A 2225
06AC6SOFTWAREIR A:2221 , CL A:2222 , CL A:2225 , CL A:2227 , HOH A:2524BINDING SITE FOR RESIDUE CL A 2226
07AC7SOFTWAREMET A:1 , LYS A:110 , IR A:2221 , CL A:2222 , CL A:2223 , CL A:2224 , CL A:2225 , CL A:2226BINDING SITE FOR RESIDUE CL A 2227
08AC8SOFTWARECL A:2229 , CL A:2230 , CL A:2231 , CL A:2232 , CL A:2233 , CL A:2234BINDING SITE FOR RESIDUE IR A 2228
09AC9SOFTWARELYS A:133 , IR A:2228 , CL A:2230 , CL A:2232 , CL A:2233BINDING SITE FOR RESIDUE CL A 2229
10BC1SOFTWARELYS A:52 , IR A:2228 , CL A:2229 , CL A:2231 , CL A:2233BINDING SITE FOR RESIDUE CL A 2230
11BC2SOFTWAREIR A:2228 , CL A:2230 , CL A:2234BINDING SITE FOR RESIDUE CL A 2231
12BC3SOFTWARELYS A:126 , LYS A:213 , IR A:2228 , CL A:2229 , CL A:2233 , CL A:2234BINDING SITE FOR RESIDUE CL A 2232
13BC4SOFTWARELYS A:133 , LYS A:213 , IR A:2228 , CL A:2229 , CL A:2230 , CL A:2232 , CL A:2234BINDING SITE FOR RESIDUE CL A 2233
14BC5SOFTWARELYS A:213 , IR A:2228 , CL A:2231 , CL A:2232 , CL A:2233 , HOH A:2529BINDING SITE FOR RESIDUE CL A 2234

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1C1K)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1C1K)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1C1K)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1C1K)

(-) Exons   (0, 0)

(no "Exon" information available for 1C1K)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:217
 aligned with VG59_BPT4 | P13342 from UniProtKB/Swiss-Prot  Length:217

    Alignment length:217
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       
            VG59_BPT4     1 MIKLRMPAGGERYIDGKSVYKLYLMIKQHMNGKYDVIKYNWCMRVSDAAYQKRRDKYFFQKLSEKYKLKELALIFISNLVANQDAWIGDISDADALVFYREYIGRLKQIKFKFEEDIRNIYYFSKKVEVSAFKEIFEYNPKVQSSYIFKLLQSNIISFETFILLDSFLNIIDKHDEQTDNLVWNNYSIKLKAYRKILNIDSQKAKNVFIETVKSCKY 217
               SCOP domains d1c1ka_ A: gene 59 helicase assembly protein                                                                                                                                                                              SCOP domains
               CATH domains 1c1kA1c1kA01 A:6-107  [code=1.10.8.60, no name defined]                                                    1c1kA02 A:1-5,A:108-217  [code=1.10.220.50, no name defined]                                                   CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eee..........hhhhhhhhhhhhhhhhh..............hhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhh........hhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhheeehhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1c1k A   1 MIKLRMPAGGERYIDGKSVYKLYLMIKQHMNGKYDVIKYNWCMRVSDAAYQKRRDKYFFQKLSEKYKLKELALIFISNLVANQDAWIGDISDADALVFYREYIGRLKQIKFKFEEDIRNIYYFSKKVEVSAFKEIFEYNPKVQSSYIFKLLQSNIISFETFILLDSFLNIIDKHDEQTDNLVWNNYSIKLKAYRKILNIDSQKAKNVFIETVKSCKY 217
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

Asymmetric/Biological Unit

(-) CATH Domains  (2, 2)

Asymmetric/Biological Unit

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1C1K)

(-) Gene Ontology  (3, 3)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A   (VG59_BPT4 | P13342)
molecular function
    GO:0003677    DNA binding    Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
biological process
    GO:0006260    DNA replication    The cellular metabolic process in which a cell duplicates one or more molecules of DNA. DNA replication begins when specific sequences, known as origins of replication, are recognized and bound by initiation proteins, and ends when the original DNA molecule has been completely duplicated and the copies topologically separated. The unit of replication usually corresponds to the genome of the cell, an organelle, or a virus. The template for replication can either be an existing DNA molecule or RNA.
    GO:0039686    bidirectional double-stranded viral DNA replication    A viral DNA replication process where replication occurs in both directions from the starting point. This creates two replication forks, moving in opposite directions.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    CL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    IR  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    BC1  [ RasMol ]  +environment [ RasMol ]
    BC2  [ RasMol ]  +environment [ RasMol ]
    BC3  [ RasMol ]  +environment [ RasMol ]
    BC4  [ RasMol ]  +environment [ RasMol ]
    BC5  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1c1k)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1c1k
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  VG59_BPT4 | P13342
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  VG59_BPT4 | P13342
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1C1K)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1C1K)