Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Biol.Unit 1 - manually
(-)Asym.Unit - manually
(-)Asymmetric Unit
(-)Biological Unit 1
collapse expand < >
Image Biol.Unit 1 - manually
Biol.Unit 1 - manually  (Jmol Viewer)
Image Asym.Unit - manually
Asym.Unit - manually  (Jmol Viewer)
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)

(-) Description

Title :  LIGAND-FREE CONGERIN I
 
Authors :  T. Shirai, C. Mitsuyama, Y. Niwa, Y. Matsui, H. Hotta, T. Yamane, H. Kami C. Ishii, T. Ogawa, K. Muramoto
Date :  03 Mar 99  (Deposition) - 08 Oct 99  (Release) - 20 Apr 16  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.60
Chains :  Asym. Unit :  A
Biol. Unit 1:  A  (2x)
Keywords :  Galectin, Lectin, Beta-Galactose-Binding, Sugar Binding Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  T. Shirai, C. Mitsuyama, Y. Niwa, Y. Matsui, H. Hotta, T. Yamane, H. Kamiya, C. Ishii, T. Ogawa, K. Muramoto
High-Resolution Structure Of The Conger Eel Galectin, Congerin I, In Lactose-Liganded And Ligand-Free Forms: Emergence Of A New Structure Class By Accelerated Evolution
Structure Fold. Des. V. 7 1223 1999
PubMed-ID: 10545323  |  Reference-DOI: 10.1016/S0969-2126(00)80056-8

(-) Compounds

Molecule 1 - PROTEIN (CONGERIN I)
    Chains: A
    Fragment: CARBOHYDRATE-RECOGNITION-DOMAIN
    Organism Common: WHITESPOTTED CONGER
    Organism Scientific: CONGER MYRIASTER
    Organism Taxid: 7943
    Secretion: NON-CLASSICAL
    Tissue: SKIN MUCUS

 Structural Features

(-) Chains, Units

  1
Asymmetric Unit : A
Biological Unit 1 (2x): A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1C1F)

(-) Sites  (0, 0)

(no "Site" information available for 1C1F)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1C1F)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1C1F)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1C1F)

(-) PROSITE Motifs  (1, 1)

Asymmetric Unit (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1GALECTINPS51304 Galactoside-binding lectin (galectin) domain profile.LEG1_CONMY3-135  1A:3-134
Biological Unit 1 (1, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1GALECTINPS51304 Galactoside-binding lectin (galectin) domain profile.LEG1_CONMY3-135  2A:3-134

(-) Exons   (0, 0)

(no "Exon" information available for 1C1F)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:135
 aligned with LEG1_CONMY | P26788 from UniProtKB/Swiss-Prot  Length:135

    Alignment length:135
                                                                                                                                                               135 
                                    11        21        31        41        51        61        71        81        91       101       111       121       131   | 
           LEG1_CONMY     2 GGLQVKNFDFTVGKFLTVGGFINNSPQRFSVNVGESMNSLSLHLDHRFNYGADQNTIVMNSTLKGDNGWETEQRSTNFTLSAGQYFEITLSYDINKFYIDILDGPNLEFPNRYSKEFLPFLSLAGDARLTLVKE-   -
               SCOP domains d1c1fa_ A: Congerin I                                                                                                                   SCOP domains
               CATH domains 1c1fA00 A:2-136  [code=2.60.120.200, no name defined]                                                                                   CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeee.........eeeeeeee.....eeeeeee.....eeeeeeeeee....eeeeeeeee..hhh.....eee.........eeeeeeee...eeeeee....eeeee.........eeeeee.eeeeeeeee Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -GALECTIN  PDB: A:3-134 UniProt: 3-135                                                                                                - PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1c1f A   2 GGLQVKNFDFTVGKFLTVGGFINNSPQRFSVNVGESMNSLSLHLDHRFNYGADQNTIVMNSTLKGDNGWETEQRSTNFTLSAGQYFEITLSYDINKFYIDILDGPNLEFPNRYSKEFLPFLSLAGDARLTLVKLE 136
                                    11        21        31        41        51        61        71        81        91       101       111       121       131
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

Asymmetric Unit
(-)
Class: All beta proteins (24004)

(-) CATH Domains  (1, 1)

Asymmetric Unit
(-)
Class: Mainly Beta (13760)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1C1F)

(-) Gene Ontology  (1, 1)

Asymmetric Unit(hide GO term definitions)
Chain A   (LEG1_CONMY | P26788)
molecular function
    GO:0030246    carbohydrate binding    Interacting selectively and non-covalently with any carbohydrate, which includes monosaccharides, oligosaccharides and polysaccharides as well as substances derived from monosaccharides by reduction of the carbonyl group (alditols), by oxidation of one or more hydroxy groups to afford the corresponding aldehydes, ketones, or carboxylic acids, or by replacement of one or more hydroxy group(s) by a hydrogen atom. Cyclitols are generally not regarded as carbohydrates.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1c1f)
 
  Sites
(no "Sites" information available for 1c1f)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1c1f)
 
Biological Unit
  Complete Structure
    Biological Unit 1  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Biol. Unit 1 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1c1f
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  LEG1_CONMY | P26788
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  LEG1_CONMY | P26788
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        LEG1_CONMY | P26788: 1c1l

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1C1F)