|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 1)
Asymmetric/Biological Unit (1, 1)
|
Sites (2, 2)
Asymmetric Unit (2, 2)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 1BXV) |
Cis Peptide Bonds (2, 2)
Asymmetric/Biological Unit
|
||||||||||||
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1BXV) |
PROSITE Motifs (1, 1)
Asymmetric/Biological Unit (1, 1)
|
||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 1BXV) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:91 aligned with PLAS_SYNE7 | P55020 from UniProtKB/Swiss-Prot Length:125 Alignment length:91 44 54 64 74 84 94 104 114 124 PLAS_SYNE7 35 QTVAIKMGADNGMLAFEPSTIEIQAGDTVQWVNNKLAPHNVVVEGQPELSHKDLAFSPGETFEATFSEPGTYTYYCEPHRGAGMVGKIVVQ 125 SCOP domains d1bxva_ A: Plastocyanin SCOP domains CATH domains 1bxvA00 A:-2-99 Cupredoxins - blue copper proteins CATH domains Pfam domains ------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------------------------------------COPPER_BLUE ------- PROSITE Transcript ------------------------------------------------------------------------------------------- Transcript 1bxv A -2 QTVAIKMGADNGMLAFEPSTIEIQAGDTVQWVNNKLAPHNVVVEGQPELSHKDLAFSPGETFEATFSEPGTYTYYCEPHRGAGMVGKIVVQ 99 || 8 18 28 38 ||| 56 || 68 78 88 98 || 42|| 59| -1| 49| 62 1 52
|
||||||||||||||||||||
SCOP Domains (1, 1)
Asymmetric/Biological Unit
|
CATH Domains (1, 1)
Asymmetric/Biological Unit
|
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 1BXV) |
Gene Ontology (7, 7)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A (PLAS_SYNE7 | P55020)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|