Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit - manually
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit - manually
Asym./Biol. Unit - manually  (Jmol Viewer)
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  INOSAMINE-PHOSPHATE AMIDINOTRANSFERASE STRB1 FROM STREPTOMYCES GRISEUS
 
Authors :  E. Fritsche, A. Bergner, A. Humm, W. Piepersberg, R. Huber
Date :  23 Sep 98  (Deposition) - 13 Jan 99  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  3.10
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Amidinotransferase, Streptomycin (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  E. Fritsche, A. Bergner, A. Humm, W. Piepersberg, R. Huber
Crystal Structure Of L-Arginine:Inosamine-Phosphate Amidinotransferase Strb1 From Streptomyces Griseus: An Enzyme Involved In Streptomycin Biosynthesis.
Biochemistry V. 37 17664 1998
PubMed-ID: 9922132  |  Reference-DOI: 10.1021/BI981949P
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - PROTEIN (INOSAMINE-PHOSPHATE AMIDINOTRANSFERASE)
    Chains: A, B
    EC Number: 2.1.4.2
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Gene: STRB1
    Expression System Plasmid: PRSET-STRB1
    Expression System Strain: BL(21)DE3PLYSS
    Expression System Taxid: 562
    Gene: STRB1
    Organism Scientific: STREPTOMYCES GRISEUS
    Organism Taxid: 1911
    Synonym: ADT

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit : AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1BWD)

(-) Sites  (0, 0)

(no "Site" information available for 1BWD)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1BWD)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1BWD)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (1, 2)

Asymmetric/Biological Unit (1, 2)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_STRB1_STRGR_001 *G329RSTRB1_STRGR  ---  ---A/BG329R
   * ID not provided by source
  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1BWD)

(-) Exons   (0, 0)

(no "Exon" information available for 1BWD)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:348
 aligned with STRB1_STRGR | P08078 from UniProtKB/Swiss-Prot  Length:347

    Alignment length:348
                                                                                                                                                                                                                                                                                                                                                                               341      
                                                                                                                                                                                                                                                                                                                                                                             340 |      
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340 |      
          STRB1_STRGR     1 MSLVSVHNEWDPLEEVIVGTAVGARVPTADRSVFAVEYAGDYESQEQIPSGAYPDRVLKETEEELHVLAAELTKLGVTVRRPGPRDHSALIKTPDWETDGFHDYCPRDGLLSVGQTIIETPMALRSRFLESLAYKDLLLEYFASGSRWLSAPKPRLTDDSYAPQAPAGERLTDEEPVFDAANVLRFGTDLLYLVSDSGNELGAKWLQSAVGDTYTVHPCRKLYASTHVDSTIVPLRPGLVLTNPSRVNDENMPDFLRSWENITCPELVDIGFTGDKPHCSVWIGMNLLVVRPDLAVVDRRQTALIRLLEKHGMNVLPLQLTHSRTLGGGFHCATLDVRRT-ARETYQF 347
               SCOP domains d1bwda_ A: L-arginine: inosamine-phosphate amidinotransferase                                                                                                                                                                                                                                                                                                SCOP domains
               CATH domains 1bwdA00 A:1-348 L-arginine/glycine Amidinotransferase; Chain A                                                                                                                                                                                                                                                                                               CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ...........eeeeee.............hhhhhh........hhh.......hhhhhhhhhhhhhhhhhhhh...eee.........................hhh.eee...eeee.....hhh..hhhhhhhhhhhhh....eeee.......hhh...................hhheeee..eeeee......hhhhhhhhhhh....eeeee........hhh.eeeee..eeee...........hhh...eeee.................hhhhh..eeee..eeeee...hhhhhhhhhh..eeeee....hhhh...........eee........ Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------R------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 1bwd A   1 RSLVSVHNEWDPLEEVIVGTAVGARVPTADRSVFAVEYAGDYESQEQIPSGAYPDRVLKETEEELHVLAAELTKLGVTVRRPGPRDHSALIKTPDWETDGFHDYCPRDGLLSVGQTIIETPMALRSRFLESLAYKDLLLEYFASGSRWLSAPKPRLTDDSYAPQAPAGERLTDEEPVFDAANVLRFGTDLLYLVSDSGNELGAKWLQSAVGDTYTVHPCRKLYASTHVDSTIVPLRPGLVLTNPSRVNDENMPDFLRSWENITCPELVDIGFTGDKPHCSVWIGMNLLVVRPDLAVVDRRQTALIRLLEKHGMNVLPLQLTHSRTLGGGFHCATLDVRRTGALETYQF 348
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340        


Chain B from PDB  Type:PROTEIN  Length:348
 aligned with STRB1_STRGR | P08078 from UniProtKB/Swiss-Prot  Length:347

    Alignment length:348
                                                                                                                                                                                                                                                                                                                                                                               341      
                                                                                                                                                                                                                                                                                                                                                                             340 |      
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340 |      
          STRB1_STRGR     1 MSLVSVHNEWDPLEEVIVGTAVGARVPTADRSVFAVEYAGDYESQEQIPSGAYPDRVLKETEEELHVLAAELTKLGVTVRRPGPRDHSALIKTPDWETDGFHDYCPRDGLLSVGQTIIETPMALRSRFLESLAYKDLLLEYFASGSRWLSAPKPRLTDDSYAPQAPAGERLTDEEPVFDAANVLRFGTDLLYLVSDSGNELGAKWLQSAVGDTYTVHPCRKLYASTHVDSTIVPLRPGLVLTNPSRVNDENMPDFLRSWENITCPELVDIGFTGDKPHCSVWIGMNLLVVRPDLAVVDRRQTALIRLLEKHGMNVLPLQLTHSRTLGGGFHCATLDVRRT-ARETYQF 347
               SCOP domains d1bwdb_ B: L-arginine: inosamine-phosphate amidinotransferase                                                                                                                                                                                                                                                                                                SCOP domains
               CATH domains 1bwdB00 B:1-348 L-arginine/glycine Amidinotransferase; Chain A                                                                                                                                                                                                                                                                                               CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ...........eeeeee.............hhhhhh........hhh.......hhhhhhhhhhhhhhhhhhhh...eee.........................hhhheee...eeee.....hhh..hhhhhhhhhhhhh....eeee.......hhh...................hhheeee..eeeee......hhhhhhhhhhh....eeeee........hhh.eeeee..eeee...........hhh...eeee.................hhhhh..eeee..eeeee...hhhhhhhhhh..eeeee....hhhh...........eee........ Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------R------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 1bwd B   1 RSLVSVHNEWDPLEEVIVGTAVGARVPTADRSVFAVEYAGDYESQEQIPSGAYPDRVLKETEEELHVLAAELTKLGVTVRRPGPRDHSALIKTPDWETDGFHDYCPRDGLLSVGQTIIETPMALRSRFLESLAYKDLLLEYFASGSRWLSAPKPRLTDDSYAPQAPAGERLTDEEPVFDAANVLRFGTDLLYLVSDSGNELGAKWLQSAVGDTYTVHPCRKLYASTHVDSTIVPLRPGLVLTNPSRVNDENMPDFLRSWENITCPELVDIGFTGDKPHCSVWIGMNLLVVRPDLAVVDRRQTALIRLLEKHGMNVLPLQLTHSRTLGGGFHCATLDVRRTGALETYQF 348
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Class: Alpha and beta proteins (a+b) (23004)

(-) CATH Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1BWD)

(-) Gene Ontology  (5, 5)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B   (STRB1_STRGR | P08078)
molecular function
    GO:0015067    amidinotransferase activity    Catalysis of the reversible transfer of an amidino group to an acceptor.
    GO:0015069    scyllo-inosamine-4-phosphate amidinotransferase activity    Catalysis of the reaction: 1-amino-1-deoxy-scyllo-inositol 4-phosphate + L-arginine = 1-guanidino-1-deoxy-scyllo-inositol 4-phosphate + L-ornithine.
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
    GO:0017000    antibiotic biosynthetic process    The chemical reactions and pathways resulting in the formation of an antibiotic, a substance produced by or derived from certain fungi, bacteria, and other organisms, that can destroy or inhibit the growth of other microorganisms.
    GO:0019872    streptomycin biosynthetic process    The chemical reactions and pathways resulting in the formation of streptomycin, a commonly used antibiotic in cell culture media; it acts only on prokaryotes and blocks transition from initiation complex to chain elongating ribosome.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1bwd)
 
  Sites
(no "Sites" information available for 1bwd)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1bwd)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1bwd
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  STRB1_STRGR | P08078
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  2.1.4.2
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  STRB1_STRGR | P08078
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1BWD)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1BWD)