Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
(-)Biological Unit 3
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)
Image Biological Unit 3
Biological Unit 3  (Jmol Viewer)

(-) Description

Title :  RUVA COMPLEXED TO A HOLLIDAY JUNCTION.
 
Authors :  S. M. Roe, L. H. Pearl
Date :  17 Sep 98  (Deposition) - 23 Sep 98  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  3.00
Chains :  Asym. Unit :  A,B,C,D,E,F,G,H
Biol. Unit 1:  A,B,C,D,E,F,G,H  (1x)
Biol. Unit 2:  A,B,C,D  (1x)
Biol. Unit 3:  E,F,G,H  (1x)
Keywords :  Holliday Junction Resolvase Component, Branch Migration, Dna Repair, Dna Binding Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  S. M. Roe, T. Barlow, T. Brown, M. Oram, A. Keeley, I. R. Tsaneva, L. H. Pearl
Crystal Structure Of An Octameric Ruva-Holliday Junction Complex.
Mol. Cell V. 2 361 1998
PubMed-ID: 9774974  |  Reference-DOI: 10.1016/S1097-2765(00)80280-4

(-) Compounds

Molecule 1 - PROTEIN (HOLLIDAY JUNCTION DNA HELICASE RUVA)
    Chains: A, B, C, D, E, F, G, H
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Cell Line: BL21(DE3)
    Expression System Plasmid: PET21-RUVA
    Expression System Taxid: 562
    Organism Scientific: MYCOBACTERIUM LEPRAE
    Organism Taxid: 1769

 Structural Features

(-) Chains, Units

  12345678
Asymmetric Unit : ABCDEFGH
Biological Unit 1 (1x): ABCDEFGH
Biological Unit 2 (1x): ABCD    
Biological Unit 3 (1x):     EFGH

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1BVS)

(-) Sites  (1, 1)

Asymmetric Unit (1, 1)
No.NameEvidenceResiduesDescription
1HHHAUTHORVAL A:77 , VAL A:112HELIX-HAIRPIN-HELIX (HHH) DNA BINDING MOTIF

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1BVS)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1BVS)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1BVS)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1BVS)

(-) Exons   (0, 0)

(no "Exon" information available for 1BVS)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:183
 aligned with RUVA_MYCLE | P40832 from UniProtKB/Swiss-Prot  Length:203

    Alignment length:203
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200   
           RUVA_MYCLE     1 MIFSVRGEVLEVALDHAVIEAAGIGYRVNATPSALATLRQGSQARLVTAMVVREDSMTLYGFSDAENRDLFLALLSVSGVGPRLAMATLAVHDAAALRQALADSDVASLTRVPGIGKRGAERIVLELRDKVGPVGASGLTVGTAADGNAVRGSVVEALVGLGFAAKQAEEATDQVLDGELGKDGAVATSSALRAALSLLGKTR 203
               SCOP domains d1bvsa3 A:1-63 DNA helicase RuvA subunit, N-terminal domain    d1bvsa2 A:64-134 DNA helicase RuvA subunit, middle domain                           d1bvsa1 A:148-203                                        SCOP domains
               CATH domains 1bvsA01 A:1-65 Nucleic acid-binding proteins                     1bvsA02 A:66-148 5' to 3' exonuclease, C-terminal subdomain                        1bvsA03 A:149-199                                  ---- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeee.eeeeee....eeeee..eee....hhhhhh......ee...eeeeee..eeeeee..hhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhh...hhhhhhh....hhhhhhhhhhhhhhhhh..-------------.hhhhhhhhhhhhhh.hhhhhhhhhhhhhhh.-------hhhhhhhh......... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1bvs A   1 MIFSVRGEVLEVALDHAVIEAAGIGYRVNATPSALATLNQGSQARLVTAMVVREDSMTLYGFSDAENRDLFLALLSVSGVGPRLAMATLAVHDAAALRQALADSDVASLTRVPGIGRRGAERIVLELADKVGPV-------------NAVRGSVVEALVGLGFAAKQAEEATDQVLDGE-------ATSSALRAALSLLGKTR 203
                                    10        20        30        40        50        60        70        80        90       100       110       120       130   |     -       150       160       170        |-      |190       200   
                                                                                                                                                               134           148                            179     187                

Chain B from PDB  Type:PROTEIN  Length:183
 aligned with RUVA_MYCLE | P40832 from UniProtKB/Swiss-Prot  Length:203

    Alignment length:203
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200   
           RUVA_MYCLE     1 MIFSVRGEVLEVALDHAVIEAAGIGYRVNATPSALATLRQGSQARLVTAMVVREDSMTLYGFSDAENRDLFLALLSVSGVGPRLAMATLAVHDAAALRQALADSDVASLTRVPGIGKRGAERIVLELRDKVGPVGASGLTVGTAADGNAVRGSVVEALVGLGFAAKQAEEATDQVLDGELGKDGAVATSSALRAALSLLGKTR 203
               SCOP domains d1bvsb3 B:1-63 DNA helicase RuvA subunit, N-terminal domain    d1bvsb2 B:64-133 DNA helicase RuvA subunit, middle domain                          d1bvsb1 B:147-203                                         SCOP domains
               CATH domains 1bvsB01 B:1-65 Nucleic acid-binding proteins                     1bvsB02 B:66-148 5' to 3' exonuclease, C-terminal subdomain                        1bvsB03 B:149-199                                  ---- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeee.eee........eeee..eeee.eehhhhhhh.....ee.....eeee..eeeeee..hhhhhhhhhhhhhh..hhhhhhhhhhhh...hhhhhhhh...hhhhhh....hhhhhhhhhhh.......-------------.hhhhhhhhhhhhhh......hhhhhhhhhh..-------hhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1bvs B   1 MIFSVRGEVLEVALDHAVIEAAGIGYRVNATPSALATLNQGSQARLVTAMVVREDSMTLYGFSDAENRDLFLALLSVSGVGPRLAMATLAVHDAAALRQALADSDVASLTRVPGIGRRGAERIVLELADKVGP-------------GNAVRGSVVEALVGLGFAAKQAEEATDQVLDGE-------ATSSALRAALSLLGKTR 203
                                    10        20        30        40        50        60        70        80        90       100       110       120       130  |      -      |150       160       170        |-      |190       200   
                                                                                                                                                              133           147                             179     187                

Chain C from PDB  Type:PROTEIN  Length:183
 aligned with RUVA_MYCLE | P40832 from UniProtKB/Swiss-Prot  Length:203

    Alignment length:203
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200   
           RUVA_MYCLE     1 MIFSVRGEVLEVALDHAVIEAAGIGYRVNATPSALATLRQGSQARLVTAMVVREDSMTLYGFSDAENRDLFLALLSVSGVGPRLAMATLAVHDAAALRQALADSDVASLTRVPGIGKRGAERIVLELRDKVGPVGASGLTVGTAADGNAVRGSVVEALVGLGFAAKQAEEATDQVLDGELGKDGAVATSSALRAALSLLGKTR 203
               SCOP domains d1bvsc3 C:1-63 DNA helicase RuvA subunit, N-terminal domain    d1bvsc2 C:64-134 DNA helicase RuvA subunit, middle domain                           d1bvsc1 C:148-203                                        SCOP domains
               CATH domains 1bvsC01 C:1-65 Nucleic acid-binding proteins                     1bvsC02 C:66-148 5' to 3' exonuclease, C-terminal subdomain                        1bvsC03 C:149-199                                  ---- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeee.eeeeee....eeeee..eee....hhhhhh......ee...eeeeee..eeeeee..hhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhh...hhhhhhh....hhhhhhhhhhhhhhhhh..-------------.hhhhhhhhhhhhhh.hhhhhhhhhhhhhhh.-------hhhhhhhh......... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1bvs C   1 MIFSVRGEVLEVALDHAVIEAAGIGYRVNATPSALATLNQGSQARLVTAMVVREDSMTLYGFSDAENRDLFLALLSVSGVGPRLAMATLAVHDAAALRQALADSDVASLTRVPGIGRRGAERIVLELADKVGPV-------------NAVRGSVVEALVGLGFAAKQAEEATDQVLDGE-------ATSSALRAALSLLGKTR 203
                                    10        20        30        40        50        60        70        80        90       100       110       120       130   |     -       150       160       170        |-      |190       200   
                                                                                                                                                               134           148                            179     187                

Chain D from PDB  Type:PROTEIN  Length:183
 aligned with RUVA_MYCLE | P40832 from UniProtKB/Swiss-Prot  Length:203

    Alignment length:203
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200   
           RUVA_MYCLE     1 MIFSVRGEVLEVALDHAVIEAAGIGYRVNATPSALATLRQGSQARLVTAMVVREDSMTLYGFSDAENRDLFLALLSVSGVGPRLAMATLAVHDAAALRQALADSDVASLTRVPGIGKRGAERIVLELRDKVGPVGASGLTVGTAADGNAVRGSVVEALVGLGFAAKQAEEATDQVLDGELGKDGAVATSSALRAALSLLGKTR 203
               SCOP domains d1bvsd3 D:1-63 DNA helicase RuvA subunit, N-terminal domain    d1bvsd2 D:64-133 DNA helicase RuvA subunit, middle domain                          d1bvsd1 D:147-203                                         SCOP domains
               CATH domains 1bvsD01 D:1-65 Nucleic acid-binding proteins                     1bvsD02 D:66-148 5' to 3' exonuclease, C-terminal subdomain                        1bvsD03 D:149-199                                  ---- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeee.eee........eeee..eeee.eehhhhhhh.....ee.....eeee..eeeeee..hhhhhhhhhhhhhh..hhhhhhhhhhhh...hhhhhhhh...hhhhhh....hhhhhhhhhhh.......-------------.hhhhhhhhhhhhhh......hhhhhhhhhh..-------hhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1bvs D   1 MIFSVRGEVLEVALDHAVIEAAGIGYRVNATPSALATLNQGSQARLVTAMVVREDSMTLYGFSDAENRDLFLALLSVSGVGPRLAMATLAVHDAAALRQALADSDVASLTRVPGIGRRGAERIVLELADKVGP-------------GNAVRGSVVEALVGLGFAAKQAEEATDQVLDGE-------ATSSALRAALSLLGKTR 203
                                    10        20        30        40        50        60        70        80        90       100       110       120       130  |      -      |150       160       170        |-      |190       200   
                                                                                                                                                              133           147                             179     187                

Chain E from PDB  Type:PROTEIN  Length:183
 aligned with RUVA_MYCLE | P40832 from UniProtKB/Swiss-Prot  Length:203

    Alignment length:203
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200   
           RUVA_MYCLE     1 MIFSVRGEVLEVALDHAVIEAAGIGYRVNATPSALATLRQGSQARLVTAMVVREDSMTLYGFSDAENRDLFLALLSVSGVGPRLAMATLAVHDAAALRQALADSDVASLTRVPGIGKRGAERIVLELRDKVGPVGASGLTVGTAADGNAVRGSVVEALVGLGFAAKQAEEATDQVLDGELGKDGAVATSSALRAALSLLGKTR 203
               SCOP domains d1bvse3 E:1-63 DNA helicase RuvA subunit, N-terminal domain    d1bvse2 E:64-134 DNA helicase RuvA subunit, middle domain                           d1bvse1 E:148-203                                        SCOP domains
               CATH domains 1bvsE01 E:1-65 Nucleic acid-binding proteins                     1bvsE02 E:66-148 5' to 3' exonuclease, C-terminal subdomain                        1bvsE03 E:149-199                                  ---- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeee.eeeeee....eeeee..eee....hhhhhh......ee...eeeeee..eeeeee..hhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhh...hhhhhhh....hhhhhhhhhhhh.......-------------.hhhhhhhhhhhhhh.hhhhhhhhhhhhhhh.-------hhhhhhhh......... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1bvs E   1 MIFSVRGEVLEVALDHAVIEAAGIGYRVNATPSALATLNQGSQARLVTAMVVREDSMTLYGFSDAENRDLFLALLSVSGVGPRLAMATLAVHDAAALRQALADSDVASLTRVPGIGRRGAERIVLELADKVGPV-------------NAVRGSVVEALVGLGFAAKQAEEATDQVLDGE-------ATSSALRAALSLLGKTR 203
                                    10        20        30        40        50        60        70        80        90       100       110       120       130   |     -       150       160       170        |-      |190       200   
                                                                                                                                                               134           148                            179     187                

Chain F from PDB  Type:PROTEIN  Length:183
 aligned with RUVA_MYCLE | P40832 from UniProtKB/Swiss-Prot  Length:203

    Alignment length:203
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200   
           RUVA_MYCLE     1 MIFSVRGEVLEVALDHAVIEAAGIGYRVNATPSALATLRQGSQARLVTAMVVREDSMTLYGFSDAENRDLFLALLSVSGVGPRLAMATLAVHDAAALRQALADSDVASLTRVPGIGKRGAERIVLELRDKVGPVGASGLTVGTAADGNAVRGSVVEALVGLGFAAKQAEEATDQVLDGELGKDGAVATSSALRAALSLLGKTR 203
               SCOP domains d1bvsf3 F:1-63 DNA helicase RuvA subunit, N-terminal domain    d1bvsf2 F:64-133 DNA helicase RuvA subunit, middle domain                          d1bvsf1 F:147-203                                         SCOP domains
               CATH domains 1bvsF01 F:1-65 Nucleic acid-binding proteins                     1bvsF02 F:66-147 5' to 3' exonuclease, C-terminal subdomain                       1bvsF03 F:148-199                                   ---- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeee.eee........eeee..eeee.eehhhhhhh.....ee.....eeee..eeeeee..hhhhhhhhhhhhhh..hhhhhhhhhhhh...hhhhhhhh...hhhhhh....hhhhhhhhhhh.......-------------.hhhhhhhhhhhhhh......hhhhhhhhhh..-------hhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1bvs F   1 MIFSVRGEVLEVALDHAVIEAAGIGYRVNATPSALATLNQGSQARLVTAMVVREDSMTLYGFSDAENRDLFLALLSVSGVGPRLAMATLAVHDAAALRQALADSDVASLTRVPGIGRRGAERIVLELADKVGP-------------GNAVRGSVVEALVGLGFAAKQAEEATDQVLDGE-------ATSSALRAALSLLGKTR 203
                                    10        20        30        40        50        60        70        80        90       100       110       120       130  |      -      |150       160       170        |-      |190       200   
                                                                                                                                                              133           147                             179     187                

Chain G from PDB  Type:PROTEIN  Length:183
 aligned with RUVA_MYCLE | P40832 from UniProtKB/Swiss-Prot  Length:203

    Alignment length:203
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200   
           RUVA_MYCLE     1 MIFSVRGEVLEVALDHAVIEAAGIGYRVNATPSALATLRQGSQARLVTAMVVREDSMTLYGFSDAENRDLFLALLSVSGVGPRLAMATLAVHDAAALRQALADSDVASLTRVPGIGKRGAERIVLELRDKVGPVGASGLTVGTAADGNAVRGSVVEALVGLGFAAKQAEEATDQVLDGELGKDGAVATSSALRAALSLLGKTR 203
               SCOP domains d1bvsg3 G:1-63 DNA helicase RuvA subunit, N-terminal domain    d1bvsg2 G:64-134 DNA helicase RuvA subunit, middle domain                           d1bvsg1 G:148-203                                        SCOP domains
               CATH domains 1bvsG01 G:1-65 Nucleic acid-binding proteins                     1bvsG02 G:66-148 5' to 3' exonuclease, C-terminal subdomain                        1bvsG03 G:149-199                                  ---- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeee.eeeeee....eeeee..eee....hhhhhh......ee...eeeeee..eeeeee..hhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhh...hhhhhhh....hhhhhhhhhhhhhhhhh..-------------.hhhhhhhhhhhhhh.hhhhhhhhhhhhhhh.-------hhhhhhhh......... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1bvs G   1 MIFSVRGEVLEVALDHAVIEAAGIGYRVNATPSALATLNQGSQARLVTAMVVREDSMTLYGFSDAENRDLFLALLSVSGVGPRLAMATLAVHDAAALRQALADSDVASLTRVPGIGRRGAERIVLELADKVGPV-------------NAVRGSVVEALVGLGFAAKQAEEATDQVLDGE-------ATSSALRAALSLLGKTR 203
                                    10        20        30        40        50        60        70        80        90       100       110       120       130   |     -       150       160       170        |-      |190       200   
                                                                                                                                                               134           148                            179     187                

Chain H from PDB  Type:PROTEIN  Length:183
 aligned with RUVA_MYCLE | P40832 from UniProtKB/Swiss-Prot  Length:203

    Alignment length:203
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200   
           RUVA_MYCLE     1 MIFSVRGEVLEVALDHAVIEAAGIGYRVNATPSALATLRQGSQARLVTAMVVREDSMTLYGFSDAENRDLFLALLSVSGVGPRLAMATLAVHDAAALRQALADSDVASLTRVPGIGKRGAERIVLELRDKVGPVGASGLTVGTAADGNAVRGSVVEALVGLGFAAKQAEEATDQVLDGELGKDGAVATSSALRAALSLLGKTR 203
               SCOP domains d1bvsh3 H:1-63 DNA helicase RuvA subunit, N-terminal domain    d1bvsh2 H:64-133 DNA helicase RuvA subunit, middle domain                          d1bvsh1 H:147-203                                         SCOP domains
               CATH domains 1bvsH01 H:1-65 Nucleic acid-binding proteins                     1bvsH02 H:66-148 5' to 3' exonuclease, C-terminal subdomain                        1bvsH03 H:149-199                                  ---- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeee.eee........eeee..eeee.eehhhhhhh.....ee.....eeee..eeeeee..hhhhhhhhhhhhhh..hhhhhhhhhhhh...hhhhhhhh...hhhhhh....hhhhhhhhhhh.......-------------.hhhhhhhhhhhhhh......hhhhhhhhhh..-------hhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1bvs H   1 MIFSVRGEVLEVALDHAVIEAAGIGYRVNATPSALATLNQGSQARLVTAMVVREDSMTLYGFSDAENRDLFLALLSVSGVGPRLAMATLAVHDAAALRQALADSDVASLTRVPGIGRRGAERIVLELADKVGP-------------GNAVRGSVVEALVGLGFAAKQAEEATDQVLDGE-------ATSSALRAALSLLGKTR 203
                                    10        20        30        40        50        60        70        80        90       100       110       120       130  |      -      |150       160       170        |-      |190       200   
                                                                                                                                                              133           147                             179     187                

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (3, 24)

Asymmetric Unit

(-) CATH Domains  (3, 24)

Asymmetric Unit
(-)
Class: Mainly Beta (13760)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1BVS)

(-) Gene Ontology  (13, 13)

Asymmetric Unit(hide GO term definitions)
Chain A,B,C,D,E,F,G,H   (RUVA_MYCLE | P40832)
molecular function
    GO:0005524    ATP binding    Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
    GO:0003677    DNA binding    Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
    GO:0003678    DNA helicase activity    Catalysis of the reaction: NTP + H2O = NDP + phosphate, to drive the unwinding of a DNA helix.
    GO:0009378    four-way junction helicase activity    Catalysis of the unwinding of the DNA helix of DNA containing four-way junctions, including Holliday junctions.
    GO:0004386    helicase activity    Catalysis of the reaction: NTP + H2O = NDP + phosphate, to drive the unwinding of a DNA or RNA helix.
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
biological process
    GO:0032508    DNA duplex unwinding    The process in which interchain hydrogen bonds between two strands of DNA are broken or 'melted', generating a region of unpaired single strands.
    GO:0006310    DNA recombination    Any process in which a new genotype is formed by reassortment of genes resulting in gene combinations different from those that were present in the parents. In eukaryotes genetic recombination can occur by chromosome assortment, intrachromosomal recombination, or nonreciprocal interchromosomal recombination. Intrachromosomal recombination occurs by crossing over. In bacteria it may occur by genetic transformation, conjugation, transduction, or F-duction.
    GO:0006281    DNA repair    The process of restoring DNA after damage. Genomes are subject to damage by chemical and physical agents in the environment (e.g. UV and ionizing radiations, chemical mutagens, fungal and bacterial toxins, etc.) and by free radicals or alkylating agents endogenously generated in metabolism. DNA is also damaged because of errors during its replication. A variety of different DNA repair pathways have been reported that include direct reversal, base excision repair, nucleotide excision repair, photoreactivation, bypass, double-strand break repair pathway, and mismatch repair pathway.
    GO:0009432    SOS response    An error-prone process for repairing damaged microbial DNA.
    GO:0006974    cellular response to DNA damage stimulus    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus indicating damage to its DNA from environmental insults or errors during metabolism.
cellular component
    GO:0009379    Holliday junction helicase complex    A DNA helicase complex that forms part of a Holliday junction resolvase complex, where the helicase activity is involved in the migration of the junction branch point. The best-characterized example is the E. coli RuvAB complex, in which a hexamer of RuvB subunits possesses helicase activity that is modulated by association with RuvA.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1bvs)
 
  Sites
    HHH  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1bvs)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]
    Biological Unit 3  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1bvs
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  RUVA_MYCLE | P40832
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  RUVA_MYCLE | P40832
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1BVS)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1BVS)