Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  P11 (S100A10), LIGAND OF ANNEXIN II IN COMPLEX WITH ANNEXIN II N-TERMINUS
 
Authors :  S. Rety, J. Sopkova, M. Renouard, D. Osterloh, V. Gerke, F. Russo- Marie, A. Lewit-Bentley
Date :  02 Sep 98  (Deposition) - 27 Jan 99  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.40
Chains :  Asym. Unit :  A,B,C,D
Biol. Unit 1:  A,B,C,D  (1x)
Biol. Unit 2:  A,B,C,D  (2x)
Keywords :  S100 Family, Ef-Hand Protein, Complex (Ligand/Annexin), Ligand Of Annexin Ii, Calcium/Phospholipid Binding Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  S. Rety, J. Sopkova, M. Renouard, D. Osterloh, V. Gerke, S. Tabaries, F. Russo-Marie, A. Lewit-Bentley
The Crystal Structure Of A Complex Of P11 With The Annexin Ii N-Terminal Peptide.
Nat. Struct. Biol. V. 6 89 1999
PubMed-ID: 9886297  |  Reference-DOI: 10.1038/4965
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - S100A10
    Chains: A, B
    Engineered: YES
    Expression System: ESCHERICHIA COLI BL21
    Expression System Plasmid: PET23A
    Expression System Strain: BL21
    Expression System Taxid: 511693
    Organism Common: HUMAN
    Organism Scientific: HOMO SAPIENS
    Organism Taxid: 9606
    Synonym: P11, CALPACTIN LIGHT CHAIN
 
Molecule 2 - ANNEXIN II
    Chains: C, D
    Engineered: YES
    Fragment: N-TERMINAL

 Structural Features

(-) Chains, Units

  1234
Asymmetric Unit : ABCD
Biological Unit 1 (1x): ABCD
Biological Unit 2 (2x): ABCD

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 2)

Asymmetric Unit (1, 2)
No.NameCountTypeFull Name
1ACE2Mod. Amino AcidACETYL GROUP
Biological Unit 1 (1, 2)
No.NameCountTypeFull Name
1ACE2Mod. Amino AcidACETYL GROUP
Biological Unit 2 (1, 4)
No.NameCountTypeFull Name
1ACE4Mod. Amino AcidACETYL GROUP

(-) Sites  (0, 0)

(no "Site" information available for 1BT6)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1BT6)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1BT6)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1BT6)

(-) PROSITE Motifs  (1, 2)

Asymmetric Unit (1, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1S100_CABPPS00303 S-100/ICaBP type calcium binding protein signature.S10AA_HUMAN55-76
 		  2A:54-75
B:54-75
Biological Unit 1 (1, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1S100_CABPPS00303 S-100/ICaBP type calcium binding protein signature.S10AA_HUMAN55-76
 		  2A:54-75
B:54-75
Biological Unit 2 (1, 4)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1S100_CABPPS00303 S-100/ICaBP type calcium binding protein signature.S10AA_HUMAN55-76
 		  4A:54-75
B:54-75

(-) Exons   (3, 6)

Asymmetric Unit (3, 6)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1ENSGALT000000059811ENSGALE00000260630chr10:6040844-604087734ANXA2_CHICK-00--
1.2ENSGALT000000059812ENSGALE00000038976chr10:6044669-604472860ANXA2_CHICK1-16162C:0-11
D:0-11		12
12
1.3ENSGALT000000059813ENSGALE00000038968chr10:6048312-6048411100ANXA2_CHICK17-50340--
1.4ENSGALT000000059814ENSGALE00000038973chr10:6051834-605192895ANXA2_CHICK50-81320--
1.5ENSGALT000000059815ENSGALE00000038969chr10:6054494-6054607114ANXA2_CHICK82-119380--
1.6ENSGALT000000059816ENSGALE00000038977chr10:6057023-605711391ANXA2_CHICK120-150310--
1.7ENSGALT000000059817ENSGALE00000038978chr10:6058444-605852380ANXA2_CHICK150-176270--
1.8ENSGALT000000059818ENSGALE00000038979chr10:6058819-605887860ANXA2_CHICK177-196200--
1.9ENSGALT000000059819ENSGALE00000038971chr10:6059503-605959694ANXA2_CHICK197-228320--
1.10ENSGALT0000000598110ENSGALE00000260509chr10:6060248-606034396ANXA2_CHICK228-260330--
1.11ENSGALT0000000598111ENSGALE00000038975chr10:6061340-606139859ANXA2_CHICK260-279200--
1.12ENSGALT0000000598112ENSGALE00000038974chr10:6062070-6062192123ANXA2_CHICK280-320410--
1.13ENSGALT0000000598113ENSGALE00000038972chr10:6063078-6063439362ANXA2_CHICK321-339190--
2.1aENST000003688111aENSE00001448013chr1:151966866-151966228639S10AA_HUMAN-00--
2.3ENST000003688113ENSE00002193213chr1:151958727-151958575153S10AA_HUMAN1-44442A:1-43
B:1-43		43
43
2.6cENST000003688116cENSE00001148206chr1:151955800-151955391410S10AA_HUMAN45-97532A:44-91
B:44-91		48
48

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:91
 aligned with S10AA_HUMAN | P60903 from UniProtKB/Swiss-Prot  Length:97

    Alignment length:91
                                    11        21        31        41        51        61        71        81        91 
           S10AA_HUMAN    2 PSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLDQCRDGKVGFQSFFSLIAGLTIACNDYFVVHMK 92
               SCOP domains d1bt6a_ A: Calcyclin (S100)                                                                 SCOP domains
               CATH domains 1bt6A00 A:1-91 EF-hand                                                                      CATH domains
               Pfam domains ------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhhhhhhhh..e.hhhhhhhhhhh.hhhhhh.....hhhhhhhhh.......e.hhhhhhhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -----------------------------------------------------S100_CABP  PDB: A:54-7---------------- PROSITE
               Transcript 2 Exon 2.3  PDB: A:1-43 UniProt: 1-44        Exon 2.6c  PDB: A:44-91 UniProt: 45-97           Transcript 2
                  1bt6 A  1 PSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLDQCRDGKVGFQSFFSLIAGLTIACNDYFVVHMK 91
                                    10        20        30        40        50        60        70        80        90 


Chain B from PDB  Type:PROTEIN  Length:91
 aligned with S10AA_HUMAN | P60903 from UniProtKB/Swiss-Prot  Length:97

    Alignment length:91
                                    11        21        31        41        51        61        71        81        91 
           S10AA_HUMAN    2 PSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLDQCRDGKVGFQSFFSLIAGLTIACNDYFVVHMK 92
               SCOP domains d1bt6b_ B: Calcyclin (S100)                                                                 SCOP domains
               CATH domains 1bt6B00 B:1-91 EF-hand                                                                      CATH domains
               Pfam domains ------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhhhhh.....e.hhhhhhhhhhh.hhhhhh.....hhhhhhhhh.......e.hhhhhhhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -----------------------------------------------------S100_CABP  PDB: B:54-7---------------- PROSITE
               Transcript 2 Exon 2.3  PDB: B:1-43 UniProt: 1-44        Exon 2.6c  PDB: B:44-91 UniProt: 45-97           Transcript 2
                  1bt6 B  1 PSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLDQCRDGKVGFQSFFSLIAGLTIACNDYFVVHMK 91
                                    10        20        30        40        50        60        70        80        90 


Chain C from PDB  Type:PROTEIN  Length:12
 aligned with ANXA2_CHICK | P17785 from UniProtKB/Swiss-Prot  Length:339

    Alignment length:12
                                    10  
           ANXA2_CHICK    1 MSTVHEILSKLS 12
               SCOP domains ------------ SCOP domains
               CATH domains ------------ CATH domains
               Pfam domains ------------ Pfam domains
         Sec.struct. author .hhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ------------ SAPs(SNPs)
                    PROSITE ------------ PROSITE
               Transcript 1 Exon 1.2     Transcript 1
                  1bt6 C  0 xSTVHEILSKLS 11
                            |        9  
                            |           
                            0-ACE       


Chain D from PDB  Type:PROTEIN  Length:12
 aligned with ANXA2_CHICK | P17785 from UniProtKB/Swiss-Prot  Length:339

    Alignment length:12
                                    10  
           ANXA2_CHICK    1 MSTVHEILSKLS 12
               SCOP domains ------------ SCOP domains
               CATH domains ------------ CATH domains
               Pfam domains ------------ Pfam domains
         Sec.struct. author .hhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ------------ SAPs(SNPs)
                    PROSITE ------------ PROSITE
               Transcript 1 Exon 1.2     Transcript 1
                  1bt6 D  0 xSTVHEILSKLS 11
                            |        9  
                            0-ACE
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric Unit
(-)
Class: All alpha proteins (14657)

(-) CATH Domains  (1, 2)

Asymmetric Unit
(-)
Class: Mainly Alpha (13335)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1BT6)

(-) Gene Ontology  (63, 71)

Asymmetric Unit(hide GO term definitions)
Chain A,B   (S10AA_HUMAN | P60903)
molecular function
    GO:0005509    calcium ion binding    Interacting selectively and non-covalently with calcium ions (Ca2+).
    GO:0044325    ion channel binding    Interacting selectively and non-covalently with one or more specific sites on an ion channel, a protein complex that spans a membrane and forms a water-filled channel across the phospholipid bilayer allowing selective ion transport down its electrochemical gradient.
    GO:0008289    lipid binding    Interacting selectively and non-covalently with a lipid.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0042803    protein homodimerization activity    Interacting selectively and non-covalently with an identical protein to form a homodimer.
biological process
    GO:0090002    establishment of protein localization to plasma membrane    The directed movement of a protein to a specific location in the plasma membrane.
    GO:0006900    membrane budding    The evagination of a membrane, resulting in formation of a vesicle.
    GO:0001765    membrane raft assembly    The aggregation, arrangement and bonding together of a set of components to form a membrane raft, a small (10-200 nm), heterogeneous, highly dynamic, sterol- and sphingolipid-enriched membrane domains that compartmentalizes cellular processes.
    GO:0043547    positive regulation of GTPase activity    Any process that activates or increases the activity of a GTPase.
    GO:0051099    positive regulation of binding    Any process that activates or increases the rate or extent of binding, the selective interaction of a molecule with one or more specific sites on another molecule.
    GO:0051894    positive regulation of focal adhesion assembly    Any process that activates or increases the frequency, rate or extent of focal adhesion assembly, the establishment and maturation of focal adhesions.
    GO:0051496    positive regulation of stress fiber assembly    Any process that activates or increases the frequency, rate or extent of the assembly of a stress fiber, a bundle of microfilaments and other proteins found in fibroblasts.
    GO:1900026    positive regulation of substrate adhesion-dependent cell spreading    Any process that activates or increases the frequency, rate or extent of substrate adhesion-dependent cell spreading.
    GO:0051290    protein heterotetramerization    The formation of a protein heterotetramer, a macromolecular structure consisting of four noncovalently associated subunits, of which not all are identical.
cellular component
    GO:0070062    extracellular exosome    A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
    GO:0019897    extrinsic component of plasma membrane    The component of a plasma membrane consisting of gene products and protein complexes that are loosely bound to one of its surfaces, but not integrated into the hydrophobic region.
    GO:0045121    membrane raft    Any of the small (10-200 nm), heterogeneous, highly dynamic, sterol- and sphingolipid-enriched membrane domains that compartmentalize cellular processes. Small rafts can sometimes be stabilized to form larger platforms through protein-protein and protein-lipid interactions.

Chain C,D   (ANXA2_CHICK | P17785)
molecular function
    GO:0044548    S100 protein binding    Interacting selectively and non-covalently with a S100 protein. S100 is a small calcium and zinc binding protein produced in astrocytes that is implicated in Alzheimer's disease, Down Syndrome and ALS.
    GO:0005262    calcium channel activity    Enables the facilitated diffusion of a calcium ion (by an energy-independent process) involving passage through a transmembrane aqueous pore or channel without evidence for a carrier-mediated mechanism.
    GO:0005509    calcium ion binding    Interacting selectively and non-covalently with calcium ions (Ca2+).
    GO:0005544    calcium-dependent phospholipid binding    Interacting selectively and non-covalently with phospholipids, a class of lipids containing phosphoric acid as a mono- or diester, in the presence of calcium.
    GO:0048306    calcium-dependent protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules), in the presence of calcium.
    GO:0008092    cytoskeletal protein binding    Interacting selectively and non-covalently with any protein component of any cytoskeleton (actin, microtubule, or intermediate filament cytoskeleton).
    GO:0005546    phosphatidylinositol-4,5-bisphosphate binding    Interacting selectively and non-covalently with phosphatidylinositol-4,5-bisphosphate, a derivative of phosphatidylinositol in which the inositol ring is phosphorylated at the 4' and 5' positions.
    GO:0019834    phospholipase A2 inhibitor activity    Stops, prevents or reduces the activity of the enzyme phospholipase A2.
    GO:0004859    phospholipase inhibitor activity    Stops, prevents or reduces the activity of a phospholipase, an enzyme that catalyzes of the hydrolysis of a phospholipid.
    GO:0002020    protease binding    Interacting selectively and non-covalently with any protease or peptidase.
    GO:0030546    receptor activator activity    The function of interacting (directly or indirectly) with receptors such that the proportion of receptors in the active form is increased.
    GO:0046790    virion binding    Interacting selectively and non-covalently with a virion, either by binding to components of the capsid or the viral envelope.
biological process
    GO:0001525    angiogenesis    Blood vessel formation when new vessels emerge from the proliferation of pre-existing blood vessels.
    GO:0055074    calcium ion homeostasis    Any process involved in the maintenance of an internal steady state of calcium ions within an organism or cell.
    GO:0070588    calcium ion transmembrane transport    A process in which a calcium ion is transported from one side of a membrane to the other by means of some agent such as a transporter or pore.
    GO:0030199    collagen fibril organization    Any process that determines the size and arrangement of collagen fibrils within an extracellular matrix.
    GO:0042730    fibrinolysis    A process that solubilizes fibrin in the bloodstream of a multicellular organism, chiefly by the proteolytic action of plasmin.
    GO:0006900    membrane budding    The evagination of a membrane, resulting in formation of a vesicle.
    GO:0001765    membrane raft assembly    The aggregation, arrangement and bonding together of a set of components to form a membrane raft, a small (10-200 nm), heterogeneous, highly dynamic, sterol- and sphingolipid-enriched membrane domains that compartmentalizes cellular processes.
    GO:0043086    negative regulation of catalytic activity    Any process that stops or reduces the activity of an enzyme.
    GO:0032804    negative regulation of low-density lipoprotein particle receptor catabolic process    Any process that stops, prevents, or reduces the frequency, rate or extent of the chemical reactions and pathways resulting in the breakdown of low-density lipoprotein receptors.
    GO:1900121    negative regulation of receptor binding    Any process that stops, prevents or reduces the frequency, rate or extent of a protein or other molecule binding to a receptor.
    GO:0002091    negative regulation of receptor internalization    Any process that stops, prevents, or reduces the frequency, rate or extent of receptor internalization.
    GO:0036035    osteoclast development    The process whose specific outcome is the progression of a osteoclast from its formation to the mature structure. Cell development does not include the steps involved in committing a cell to a specific fate. An osteoclast is a specialized phagocytic cell associated with the absorption and removal of the mineralized matrix of bone tissue.
    GO:0051099    positive regulation of binding    Any process that activates or increases the rate or extent of binding, the selective interaction of a molecule with one or more specific sites on another molecule.
    GO:2000273    positive regulation of receptor activity    Any process that activates or increases the frequency, rate or extent of receptor activity.
    GO:0031340    positive regulation of vesicle fusion    Any process that activates or increases the frequency, rate or extent of vesicle fusion.
    GO:0051290    protein heterotetramerization    The formation of a protein heterotetramer, a macromolecular structure consisting of four noncovalently associated subunits, of which not all are identical.
cellular component
    GO:1990667    PCSK9-AnxA2 complex    A protein complex consisting of the serine protease PCSK9 (Proprotein convertase subtilisin/kexin-9) and Annexin A2 (AnxA2).
    GO:0043220    Schmidt-Lanterman incisure    Regions within compact myelin in which the cytoplasmic faces of the enveloping myelin sheath are not tightly juxtaposed, and include cytoplasm from the cell responsible for making the myelin. Schmidt-Lanterman incisures occur in the compact myelin internode, while lateral loops are analogous structures found in the paranodal region adjacent to the nodes of Ranvier.
    GO:0005604    basement membrane    A thin layer of dense material found in various animal tissues interposed between the cells and the adjacent connective tissue. It consists of the basal lamina plus an associated layer of reticulin fibers.
    GO:0016323    basolateral plasma membrane    The region of the plasma membrane that includes the basal end and sides of the cell. Often used in reference to animal polarized epithelial membranes, where the basal membrane is the part attached to the extracellular matrix, or in plant cells, where the basal membrane is defined with respect to the zygotic axis.
    GO:0034704    calcium channel complex    An ion channel complex through which calcium ions pass.
    GO:0009986    cell surface    The external part of the cell wall and/or plasma membrane.
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
    GO:0005769    early endosome    A membrane-bounded organelle that receives incoming material from primary endocytic vesicles that have been generated by clathrin-dependent and clathrin-independent endocytosis; vesicles fuse with the early endosome to deliver cargo for sorting into recycling or degradation pathways.
    GO:0005768    endosome    A vacuole to which materials ingested by endocytosis are delivered.
    GO:0070062    extracellular exosome    A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
    GO:0005615    extracellular space    That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.
    GO:0019897    extrinsic component of plasma membrane    The component of a plasma membrane consisting of gene products and protein complexes that are loosely bound to one of its surfaces, but not integrated into the hydrophobic region.
    GO:0031902    late endosome membrane    The lipid bilayer surrounding a late endosome.
    GO:0005811    lipid droplet    An intracellular non-membrane-bounded organelle comprising a matrix of coalesced lipids surrounded by a phospholipid monolayer. May include associated proteins.
    GO:0005765    lysosomal membrane    The lipid bilayer surrounding the lysosome and separating its contents from the cell cytoplasm.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0045121    membrane raft    Any of the small (10-200 nm), heterogeneous, highly dynamic, sterol- and sphingolipid-enriched membrane domains that compartmentalize cellular processes. Small rafts can sometimes be stabilized to form larger platforms through protein-protein and protein-lipid interactions.
    GO:0030496    midbody    A thin cytoplasmic bridge formed between daughter cells at the end of cytokinesis. The midbody forms where the contractile ring constricts, and may persist for some time before finally breaking to complete cytokinesis.
    GO:0035749    myelin sheath adaxonal region    The region of the myelin sheath nearest to the axon.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
    GO:0005578    proteinaceous extracellular matrix    A layer consisting mainly of proteins (especially collagen) and glycosaminoglycans (mostly as proteoglycans) that forms a sheet underlying or overlying cells such as endothelial and epithelial cells. The proteins are secreted by cells in the vicinity. An example of this component is found in Mus musculus.
    GO:0042383    sarcolemma    The outer membrane of a muscle cell, consisting of the plasma membrane, a covering basement membrane (about 100 nm thick and sometimes common to more than one fiber), and the associated loose network of collagen fibers.
    GO:0031982    vesicle    Any small, fluid-filled, spherical organelle enclosed by membrane.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    ACE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
(no "Sites" information available for 1bt6)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1bt6)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Biol. Unit 1 PNG format | Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1bt6
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  ANXA2_CHICK | P17785
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  S10AA_HUMAN | P60903
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  ANXA2_CHICK | P17785
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  S10AA_HUMAN | P60903
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        S10AA_HUMAN | P60903: 1a4p 4drw 4ftg 4hre 4hrg 4hrh

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1BT6)