Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym.Unit - manually
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
(-)Biological Unit 3
collapse expand < >
Image Asym.Unit - manually
Asym.Unit - manually  (Jmol Viewer)
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)
Image Biological Unit 3
Biological Unit 3  (Jmol Viewer)

(-) Description

Title :  ANTI-P-GLYCOPROTEIN FAB MRK-16
 
Authors :  S. Vasudevan, T. Tsuruo, D. R. Rose
Date :  16 Jul 98  (Deposition) - 28 Oct 98  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.80
Chains :  Asym. Unit :  A,B,C,D
Biol. Unit 1:  A,B,C,D  (1x)
Biol. Unit 2:  C,D  (1x)
Biol. Unit 3:  A,B  (1x)
Keywords :  Immunoglobulin, Immune System (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  S. Vasudevan, T. Tsuruo, D. R. Rose
Mode Of Binding Of Anti-P-Glycoprotein Antibody Mrk-16 To Its Antigen. A Crystallographic And Molecular Modeling Study.
J. Biol. Chem. V. 273 25413 1998
PubMed-ID: 9738009  |  Reference-DOI: 10.1074/JBC.273.39.25413
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - PROTEIN (MONOCLONAL ANTIBODY MRK-16 (LIGHT CHAIN))
    Chains: A, C
    Fragment: FAB
    Organism Common: HOUSE MOUSE
    Organism Scientific: MUS MUSCULUS
    Organism Taxid: 10090
 
Molecule 2 - PROTEIN (MONOCLONAL ANTIBODY MRK-16 (HEAVY CHAIN))
    Chains: B, D
    Fragment: FAB
    Organism Common: HOUSE MOUSE
    Organism Scientific: MUS MUSCULUS
    Organism Taxid: 10090

 Structural Features

(-) Chains, Units

  1234
Asymmetric Unit : ABCD
Biological Unit 1 (1x): ABCD
Biological Unit 2 (1x):   CD
Biological Unit 3 (1x): AB  

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1BLN)

(-) Sites  (0, 0)

(no "Site" information available for 1BLN)

(-) SS Bonds  (9, 9)

Asymmetric Unit
No.Residues
1A:23 -A:88
2A:134 -A:194
3B:22 -B:92
4B:142 -B:208
5C:23 -C:88
6C:134 -C:194
7C:214 -D:128
8D:22 -D:92
9D:142 -D:208

(-) Cis Peptide Bonds  (6, 6)

Asymmetric Unit
No.Residues
1Thr A:7 -Pro A:8
2Tyr A:140 -Pro A:141
3Phe B:148 -Pro B:149
4Thr C:7 -Pro C:8
5Tyr C:140 -Pro C:141
6Phe D:148 -Pro D:149

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1BLN)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1BLN)

(-) Exons   (0, 0)

(no "Exon" information available for 1BLN)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:214
                                                                                                                                                                                                                                                       
               SCOP domains d1blna1 A:1-107 Immunoglobulin light chain kappa variable domain, VL-kappa                                      d1blna2 A:108-214 Immunoglobulin light chain kappa constant domain, CL-kappa                           SCOP domains
               CATH domains 1blnA01 A:1-108 Immunoglobulins                                                                                  1blnA02 A:109-212 Immunoglobulins                                                                  -- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeee..eeeee....eeeeeee............eeeeee.....eeeee.............eee.....eeeeee....hhh..eeeeee............eeeee......eeeee...hhhhhh.eeeeeeeee.......eeeeee...eee..eeeee...........eeeeeeeehhhhh....eeeeee..eeeee..... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1bln A    1 DVLMTQTPVSLSVSLGDQASISCRSSQSIVHSTGNTYLEWYLQKPGQSPKLLIYKISNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQASHAPRTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATSPIVKSFNRNEC  214
                                    10        20       27C||      35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195 ||    210    
                                                     27A||||                                                                                                                                                                       197|           
                                                      27B|||                                                                                                                                                                        203           
                                                       27C||                                                                                                                                                                                      
                                                        27D|                                                                                                                                                                                      
                                                         27E                                                                                                                                                                                      


Chain B from PDB  Type:PROTEIN  Length:218
                                                                                                                                                                                                                                                           
               SCOP domains d1blnb1 B:1-113 Immunoglobulin heavy chain variable domain, VH                                                         d1blnb2 B:114-227 Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma                     SCOP domains
               CATH domains 1blnB01 B:1-113 Immunoglobulins                                                                                        1blnB02 B:114-226 Immunoglobulins                                                                 - CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeee..........eeeeeeee...hhh..eeeeeee....eeeeeee......eee.......eeeeee....eeeeee....hhh.eeeeeee..............eee..........eeeee..hhh.....eeeeeeeeeee.....eeeehhh.....eee...eee..eeeeeeeeeeehhhh....eeeeeeehhh.eeeeeee.. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1bln B    1 EVILVESGGGLVKPGGSLKLSCAASGFTFSSYTMSWVRQTPEKRLEWVATISSGGGNTYYPDSVKGRFTISRDNAKNNLYLQMSSLRSEDTALYYCARYYRYEAWFASWGQGTLVTVSAAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEP  227
                                    10        20        30        40        50  |     59        69        79   |||  86        96    || 104       114       124     ||136       146       157|      172       184       194 || || 206|      217     || 
                                                                              52A                            82A||               100A|                           130|                  154|||    169|      180|          196| || 206|            223| 
                                                                                                              82B|                100B                            133                   156||     171       183           198 ||  208             226 
                                                                                                               82C                                                                       157|                               200|                      
                                                                                                                                                                                          162                                202                      


Chain C from PDB  Type:PROTEIN  Length:214
                                                                                                                                                                                                                                                       
               SCOP domains d1blnc1 C:1-107 Immunoglobulin light chain kappa variable domain, VL-kappa                                      d1blnc2 C:108-214 Immunoglobulin light chain kappa constant domain, CL-kappa                           SCOP domains
               CATH domains 1blnC01 C:1-108 Immunoglobulins                                                                                  1blnC02 C:109-211 Immunoglobulins                                                                 --- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeee..eeeee....eeeeeee............eeeeee......eeee.............eeeeee..eeeeee....hhh.eeeeeee...........eeeeee......eeeee...hhhhhh.eeeeeeeee.......eeeeee...eee..eeeee...........eeeeeeeehhhhh....eeeeee..eeeee..... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1bln C    1 DVLMTQTPVSLSVSLGDQASISCRSSQSIVHSTGNTYLEWYLQKPGQSPKLLIYKISNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQASHAPRTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATSPIVKSFNRNEC  214
                                    10        20       27C||      35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195 ||    210    
                                                     27A||||                                                                                                                                                                       197|           
                                                      27B|||                                                                                                                                                                        203           
                                                       27C||                                                                                                                                                                                      
                                                        27D|                                                                                                                                                                                      
                                                         27E                                                                                                                                                                                      


Chain D from PDB  Type:PROTEIN  Length:218
                                                                                                                                                                                                                                                           
               SCOP domains d1blnd1 D:1-113 Immunoglobulin heavy chain variable domain, VH                                                         d1blnd2 D:114-227 Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma                     SCOP domains
               CATH domains 1blnD01 D:1-113 Immunoglobulins                                                                                        1blnD02 D:114-226 Immunoglobulins                                                                 - CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeee..eee.....eeeeeeee...hhh..eeeeee.....eeeeeee......eee.......eeeeee....eeeeee....hhh.eeeeeee..............eeeee........eeeee..hhh.....eeeeeeeeeee.....eeeehhh.....eeee..eee..eeeeeeeeeeehhhh....eeeeeeehhh.eeeeeee.. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1bln D    1 EVILVESGGGLVKPGGSLKLSCAASGFTFSSYTMSWVRQTPEKRLEWVATISSGGGNTYYPDSVKGRFTISRDNAKNNLYLQMSSLRSEDTALYYCARYYRYEAWFASWGQGTLVTVSAAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEP  227
                                    10        20        30        40        50  |     59        69        79   |||  86        96    || 104       114       124     ||136       146       157|      172       184       194 || || 206|      217     || 
                                                                              52A                            82A||               100A|                           130|                  154|||    169|      180|          196| || 206|            223| 
                                                                                                              82B|                100B                            133                   156||     171       183           198 ||  208             226 
                                                                                                               82C                                                                       157|                               200|                      
                                                                                                                                                                                          162                                202
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (4, 8)

Asymmetric Unit
(-)
Class: All beta proteins (24004)

(-) CATH Domains  (1, 8)

Asymmetric Unit
(-)
Class: Mainly Beta (13760)
(-)
Architecture: Sandwich (5577)
(-)
Topology: Immunoglobulin-like (3897)
(-)
Homologous Superfamily: Immunoglobulins (2282)
(-)
House mouse (Mus musculus) (616)
1a1blnC02C:109-211
1b1blnA01A:1-108
1c1blnC01C:1-108
1d1blnB02B:114-226
1e1blnD02D:114-226
1f1blnB01B:1-113
1g1blnD01D:1-113
1h1blnA02A:109-212

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1BLN)

(-) Gene Ontology  (0, 0)

Asymmetric Unit(hide GO term definitions)
    (no "Gene Ontology" information available for 1BLN)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1bln)
 
  Sites
(no "Sites" information available for 1bln)
 
  Cis Peptide Bonds
    Phe B:148 - Pro B:149   [ RasMol ]  
    Phe D:148 - Pro D:149   [ RasMol ]  
    Thr A:7 - Pro A:8   [ RasMol ]  
    Thr C:7 - Pro C:8   [ RasMol ]  
    Tyr A:140 - Pro A:141   [ RasMol ]  
    Tyr C:140 - Pro C:141   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]
    Biological Unit 3  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Biol. Unit 1 PNG format | Biol. Unit 2 PNG format | Biol. Unit 3 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1bln
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  (no 'UniProt ID/Accession number' available) |
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  (no 'UniProt ID/Accession number' available) |
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1BLN)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1BLN)