Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - manually
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - manually
NMR Structure - manually  (Jmol Viewer)
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  HISTONE B FROM METHANOTHERMUS FERVIDUS
 
Authors :  M. R. Starich, K. Sandman, J. N. Reeve, M. F. Summers
Date :  28 Sep 95  (Deposition) - 29 Jan 96  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A,B  (33x)
Keywords :  Archaeal Histone Protein, Dna Binding Protein Hmf-2 (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  M. R. Starich, K. Sandman, J. N. Reeve, M. F. Summers
Nmr Structure Of Hmfb From The Hyperthermophile, Methanothermus Fervidus, Confirms That This Archaeal Protein Is A Histone.
J. Mol. Biol. V. 255 187 1996
PubMed-ID: 8568866  |  Reference-DOI: 10.1006/JMBI.1996.0016
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - HISTONE B
    Cell LineJM105
    ChainsA, B
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System GeneHMFB
    Expression System PlasmidPKK223-3
    Expression System StrainJM105
    Expression System Taxid562
    GeneHMFB
    Organism ScientificMETHANOTHERMUS FERVIDUS
    Organism Taxid2180
    SynonymHMFB, RHMFB, ARCHAEAL HISTONE

 Structural Features

(-) Chains, Units

  
NMR Structure (33x)

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1BFM)

(-) Sites  (0, 0)

(no "Site" information available for 1BFM)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1BFM)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1BFM)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1BFM)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1BFM)

(-) Exons   (0, 0)

(no "Exon" information available for 1BFM)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:69
 aligned with HMFB_METFE | P19267 from UniProtKB/Swiss-Prot  Length:69

    Alignment length:69
                                    10        20        30        40        50        60         
            HMFB_METFE    1 MELPIAPIGRIIKDAGAERVSDDARITLAKILEEMGRDIASEAIKLARHAGRKTIKAEDIELAVRRFKK 69
               SCOP domains d1bfma_ A: Archaeal histone                                           SCOP domains
               CATH domains 1bfmA00 A:1-69 Histone, subunit A                                     CATH domains
               Pfam domains --------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....hhhhhhhhhhh...ee.hhhhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------- Transcript
                  1bfm A  1 MELPIAPIGRIIKDAGAERVSDDARITLAKILEEMGRDIASEAIKLARHAGRKTIKAEDIELAVRRFKK 69
                                    10        20        30        40        50        60         

Chain B from PDB  Type:PROTEIN  Length:69
 aligned with HMFB_METFE | P19267 from UniProtKB/Swiss-Prot  Length:69

    Alignment length:69
                                    10        20        30        40        50        60         
            HMFB_METFE    1 MELPIAPIGRIIKDAGAERVSDDARITLAKILEEMGRDIASEAIKLARHAGRKTIKAEDIELAVRRFKK 69
               SCOP domains d1bfmb_ B: Archaeal histone                                           SCOP domains
               CATH domains 1bfmB00 B:1-69 Histone, subunit A                                     CATH domains
               Pfam domains --------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....hhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhhhhh...ee.hhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------- Transcript
                  1bfm B  1 MELPIAPIGRIIKDAGAERVSDDARITLAKILEEMGRDIASEAIKLARHAGRKTIKAEDIELAVRRFKK 69
                                    10        20        30        40        50        60         

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

NMR Structure

(-) CATH Domains  (1, 2)

NMR Structure

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1BFM)

(-) Gene Ontology  (4, 4)

NMR Structure(hide GO term definitions)
Chain A,B   (HMFB_METFE | P19267)
molecular function
    GO:0003677    DNA binding    Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
    GO:0046982    protein heterodimerization activity    Interacting selectively and non-covalently with a nonidentical protein to form a heterodimer.
cellular component
    GO:0005694    chromosome    A structure composed of a very long molecule of DNA and associated proteins (e.g. histones) that carries hereditary information.
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1bfm)
 
  Sites
(no "Sites" information available for 1bfm)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1bfm)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1bfm
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  HMFB_METFE | P19267
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  HMFB_METFE | P19267
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        HMFB_METFE | P192671a7w 1b6w

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1BFM)