1BFJ - JenaLib

NMR Structure - manually (Jmol Viewer)

NMR Structure - model 1 (Jmol Viewer)

NMR Structure - all models (Jmol Viewer)

Title :   SOLUTION STRUCTURE OF THE C-TERMINAL SH2 DOMAIN OF THE P85ALPHA REGULATORY SUBUNIT OF PHOSPHOINOSITIDE 3-KINASE, NMR, MINIMIZED AVERAGE STRUCTURE

Authors :   G. Siegal, B. Davis, S. M. Kristensen, A. Sankar, J. Linacre, R. C. Stein, G. Panayotou, M. D. Waterfield, P. C. Driscoll

Date :   18 Nov 97 (Deposition) - 25 Feb 98 (Release) - 24 Feb 09 (Revision)

Method :   SOLUTION NMR

Resolution :   NOT APPLICABLE

Chains :   NMR Structure  : A

Keywords :   Sh2 Domain, P85Alpha, Pi 3-Kinase, Nmr, C Terminal Sh2 Domain (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   G. Siegal, B. Davis, S. M. Kristensen, A. Sankar, J. Linacre, R. C. Stein, G. Panayotou, M. D. Waterfield, P. C. Driscoll
Solution Structure Of The C-Terminal Sh2 Domain Of The P85 Alpha Regulatory Subunit Of Phosphoinositide 3-Kinase.
J. Mol. Biol. V. 276 461 1998
PubMed-ID: 9512716 | Reference-DOI: 10.1006/JMBI.1997.1562
(for further references see the PDB file header)

Molecule 1 - P85 ALPHA
	Cell Line	:	BL21
	Chains	:	A
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI BL21(DE3)
	Expression System Plasmid	:	BL21
	Expression System Strain	:	BL21 (DE3)
	Expression System Taxid	:	469008
	Expression System Vector	:	PET-23D
	Fragment	:	C TERMINAL SH2 DOMAIN
	Organ	:	BRAIN
	Organism Common	:	CATTLE
	Organism Scientific	:	BOS TAURUS
	Organism Taxid	:	9913
	Synonym	:	PHOSPHATIDYLINOSITOL 3-KINASE REGULATORY ALPHA SUBUNIT, PI3-KINASE P85-ALPHA SUBUNIT


NMR Structure	:

Summary Information (see also Sequences/Alignments below)

(no "Ligand,Modified Residues,Ions" information available for 1BFJ)

(no "Site" information available for 1BFJ)

(no "SS Bond" information available for 1BFJ)

(no "Cis Peptide Bond" information available for 1BFJ)

(no "SAP(SNP)/Variant" information available for 1BFJ)

NMR Structure (1, 1)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	SH2	PS50001	Src homology 2 (SH2) domain profile.	P85A_BOVIN	333-428 624-718	1	- A:11-105

NMR Structure (2, 2)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1	ENSBTAT00000014594	1	ENSBTAE00000118499	chr20:12172102-12171896	207	P85A_BOVIN	1-69	69	0	-	-
1.2	ENSBTAT00000014594	2	ENSBTAE00000360578	chr20:12171893-12171873	21	P85A_BOVIN	70-76	7	0	-	-
1.3	ENSBTAT00000014594	3	ENSBTAE00000360575	chr20:12171871-12171772	100	P85A_BOVIN	77-110	34	0	-	-
1.4	ENSBTAT00000014594	4	ENSBTAE00000118502	chr20:12116402-12116310	93	P85A_BOVIN	110-141	32	0	-	-
1.5	ENSBTAT00000014594	5	ENSBTAE00000118505	chr20:12115870-12115796	75	P85A_BOVIN	141-166	26	0	-	-
1.6	ENSBTAT00000014594	6	ENSBTAE00000118508	chr20:12109683-12109552	132	P85A_BOVIN	166-210	45	0	-	-
1.7	ENSBTAT00000014594	7	ENSBTAE00000118513	chr20:12108777-12108576	202	P85A_BOVIN	210-277	68	0	-	-
1.8	ENSBTAT00000014594	8	ENSBTAE00000118521	chr20:12108363-12108284	80	P85A_BOVIN	277-304	28	0	-	-
1.9	ENSBTAT00000014594	9	ENSBTAE00000118524	chr20:12096848-12096746	103	P85A_BOVIN	304-338	35	0	-	-
1.10	ENSBTAT00000014594	10	ENSBTAE00000118529	chr20:12096209-12096111	99	P85A_BOVIN	338-371	34	0	-	-
1.11	ENSBTAT00000014594	11	ENSBTAE00000118551	chr20:12095995-12095815	181	P85A_BOVIN	371-431	61	0	-	-
1.12	ENSBTAT00000014594	12	ENSBTAE00000118564	chr20:12095545-12095420	126	P85A_BOVIN	432-473	42	0	-	-
1.13	ENSBTAT00000014594	13	ENSBTAE00000118592	chr20:12094684-12094542	143	P85A_BOVIN	474-521	48	0	-	-
1.14	ENSBTAT00000014594	14	ENSBTAE00000118601	chr20:12094333-12094157	177	P85A_BOVIN	521-580	60	0	-	-
1.15	ENSBTAT00000014594	15	ENSBTAE00000118603	chr20:12094058-12093990	69	P85A_BOVIN	580-603	24	0	-	-
1.16	ENSBTAT00000014594	16	ENSBTAE00000118605	chr20:12093272-12093102	171	P85A_BOVIN	603-660	58	1	A:1-47	47
1.17	ENSBTAT00000014594	17	ENSBTAE00000385919	chr20:12092222-12092033	190	P85A_BOVIN	660-722	63	1	A:47-109	63

NMR Structure

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:111
 aligned with P85A_BOVIN | P23727 from UniProtKB/Swiss-Prot  Length:724

    Alignment length:111
                                   623       633       643       653       663       673       683       693       703       713       723 
           P85A_BOVIN   614 EDLPHHDEKTWNVGSSNRNKAENLLRGKRDGTFLVRESSKQGCYACSVVVDGEVKHCVINKTATGYGFAEPYNLYSSLKELVLHYQHTSLVQHNDSLNVTLAYPVYAQQRR 724
               SCOP domains d1bfja_ A: Phosphatidylinositol 3-kinase, p85-alpha subunit                                                     SCOP domains
               CATH domains 1bfjA00 A:1-111 SHC Adaptor Protein                                                                             CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhh.hhhh......hhhhhhhh.......eeeee......eeeeee....eeeeee..................hhhhhhhhhh........................ Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------SH2  PDB: A:11-105 UniProt: 624-718                                                            ------ PROSITE
           Transcript 1 (1) Exon 1.16  PDB: A:1-47 UniProt: 603-660        ---------------------------------------------------------------- Transcript 1 (1)
           Transcript 1 (2) ----------------------------------------------Exon 1.17  PDB: A:47-109 UniProt: 660-722                      -- Transcript 1 (2)
                 1bfj A   1 EDLPHHDEKTWNVGSSNRNKAENLLRGKRDGTFLVRESSKQGCYACSVVVDGEVKHCVINKTATGYGFAEPYNLYSSLKELVLHYQHTSLVQHNDSLNVTLAYPVYAQQRR 111
                                    10        20        30        40        50        60        70        80        90       100       110

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

NMR Structure

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: Alpha and beta proteins (a+b) (23004)

Fold: SH2-like (260)

Superfamily: SH2 domain (260)

Family: SH2 domain (225)

Protein domain: Phosphatidylinositol 3-kinase, p85-alpha subunit (11)

Cow (Bos taurus) [TaxId: 9913] (7)

d1bfja_

NMR Structure

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Alpha Beta (26913)

Architecture: 2-Layer Sandwich (8480)

Topology: SHC Adaptor Protein (206)

Homologous Superfamily: SHC Adaptor Protein (206)

Cattle (Bos taurus) (9)

1bfjA00

A:1-111

(no "Pfam Domain" information available for 1BFJ)

NMR Structure(hide GO term definitions)

Chain A (P85A_BOVIN | P23727)

molecular function
	GO:0046935	1-phosphatidylinositol-3-kinase regulator activity	Modulates the activity of the enzyme 1-phosphatidylinositol-3-kinase activity.
	GO:0043125	ErbB-3 class receptor binding	Interacting selectively and non-covalently with the protein-tyrosine kinase receptor ErbB-3/HER3.
	GO:0043559	insulin binding	Interacting selectively and non-covalently with insulin, a polypeptide hormone produced by the islets of Langerhans of the pancreas in mammals, and by the homologous organs of other organisms.
	GO:0005158	insulin receptor binding	Interacting selectively and non-covalently with the insulin receptor.
	GO:0043560	insulin receptor substrate binding	Interacting selectively and non-covalently with any of the insulin receptor substrate (IRS) proteins, adaptor proteins that bind to the transphosphorylated insulin and insulin-like growth factor receptors, are themselves phosphorylated and in turn recruit SH2 domain-containing signaling molecules to form a productive signaling complex.
	GO:0005159	insulin-like growth factor receptor binding	Interacting selectively and non-covalently with the insulin-like growth factor receptor.
	GO:0005168	neurotrophin TRKA receptor binding	Interacting selectively and non-covalently with the neurotrophin TRKA receptor.
	GO:0043548	phosphatidylinositol 3-kinase binding	Interacting selectively and non-covalently with a phosphatidylinositol 3-kinase, any enzyme that catalyzes the addition of a phosphate group to an inositol lipid at the 3' position of the inositol ring.
	GO:0035014	phosphatidylinositol 3-kinase regulator activity	Modulates the activity of any of the phosphatidylinositol 3-kinases (PI3Ks). Regulatory subunits can link a PI3K catalytic subunit to upstream signaling events and help position the catalytic subunits close to their lipid substrates.
	GO:0036312	phosphatidylinositol 3-kinase regulatory subunit binding	Interacting selectively and non-covalently with a regulatory subunit of phosphatidylinositol 3-kinase. The regulatory subunit associates with the catalytic subunit to regulate both its activity and subcellular location.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0046982	protein heterodimerization activity	Interacting selectively and non-covalently with a nonidentical protein to form a heterodimer.
	GO:0019903	protein phosphatase binding	Interacting selectively and non-covalently with any protein phosphatase.
	GO:0008134	transcription factor binding	Interacting selectively and non-covalently with a transcription factor, any protein required to initiate or regulate transcription.
	GO:0005068	transmembrane receptor protein tyrosine kinase adaptor activity	The binding activity of a molecule that brings together a transmembrane receptor protein tyrosine kinase and one or more other molecules, permitting them to function in a coordinated way.
biological process
	GO:0030183	B cell differentiation	The process in which a precursor cell type acquires the specialized features of a B cell. A B cell is a lymphocyte of B lineage with the phenotype CD19-positive and capable of B cell mediated immunity.
	GO:0051531	NFAT protein import into nucleus	The directed movement of NFAT (nuclear factor of activated T cells) proteins, a family of transcription factors, from the cytoplasm into the nucleus. NFAT proteins are dephosphorylated in the cytoplasm by activated calcineurin, which leads to their translocation across the nuclear membrane.
	GO:0001678	cellular glucose homeostasis	A cellular homeostatic process involved in the maintenance of an internal steady state of glucose within a cell or between a cell and its external environment.
	GO:0034644	cellular response to UV	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an ultraviolet radiation (UV light) stimulus. Ultraviolet radiation is electromagnetic radiation with a wavelength in the range of 10 to 380 nanometers.
	GO:0032869	cellular response to insulin stimulus	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an insulin stimulus. Insulin is a polypeptide hormone produced by the islets of Langerhans of the pancreas in mammals, and by the homologous organs of other organisms.
	GO:0008625	extrinsic apoptotic signaling pathway via death domain receptors	A series of molecular signals in which a signal is conveyed from the cell surface to trigger the apoptotic death of a cell. The pathway starts with a ligand binding to a death domain receptor on the cell surface, and ends when the execution phase of apoptosis is triggered.
	GO:0060396	growth hormone receptor signaling pathway	The series of molecular signals generated as a consequence of growth hormone receptor binding to its physiological ligand.
	GO:0008286	insulin receptor signaling pathway	The series of molecular signals generated as a consequence of the insulin receptor binding to insulin.
	GO:0048009	insulin-like growth factor receptor signaling pathway	The series of molecular signals generated as a consequence of the insulin-like growth factor receptor binding to one of its physiological ligands.
	GO:0008630	intrinsic apoptotic signaling pathway in response to DNA damage	A series of molecular signals in which an intracellular signal is conveyed to trigger the apoptotic death of a cell. The pathway is induced by the detection of DNA damage, and ends when the execution phase of apoptosis is triggered.
	GO:0043066	negative regulation of apoptotic process	Any process that stops, prevents, or reduces the frequency, rate or extent of cell death by apoptotic process.
	GO:0007162	negative regulation of cell adhesion	Any process that stops, prevents, or reduces the frequency, rate or extent of cell adhesion.
	GO:0001953	negative regulation of cell-matrix adhesion	Any process that stops, prevents, or reduces the rate or extent of cell adhesion to the extracellular matrix.
	GO:0045671	negative regulation of osteoclast differentiation	Any process that stops, prevents, or reduces the frequency, rate or extent of osteoclast differentiation.
	GO:0014065	phosphatidylinositol 3-kinase signaling	A series of reactions within the signal-receiving cell, mediated by the intracellular phosphatidylinositol 3-kinase (PI3K). Many cell surface receptor linked signaling pathways signal through PI3K to regulate numerous cellular functions.
	GO:0046854	phosphatidylinositol phosphorylation	The process of introducing one or more phosphate groups into a phosphatidylinositol, any glycerophosphoinositol having one phosphatidyl group esterified to one of the hydroxy groups of inositol.
	GO:0033120	positive regulation of RNA splicing	Any process that activates or increases the frequency, rate or extent of RNA splicing.
	GO:0030335	positive regulation of cell migration	Any process that activates or increases the frequency, rate or extent of cell migration.
	GO:1900103	positive regulation of endoplasmic reticulum unfolded protein response	Any process that activates or increases the frequency, rate or extent of endoplasmic reticulum unfolded protein response.
	GO:0090004	positive regulation of establishment of protein localization to plasma membrane	Any process that increases the frequency, rate or extent of the directed movement of a protein to a specific location in the plasma membrane.
	GO:0046326	positive regulation of glucose import	Any process that activates or increases the frequency, rate or extent of the import of the hexose monosaccharide glucose into a cell or organelle.
	GO:2001275	positive regulation of glucose import in response to insulin stimulus	Any process that activates or increases the frequency, rate or extent of glucose import in response to insulin stimulus.
	GO:0042993	positive regulation of transcription factor import into nucleus	Any process that activates or increases the frequency, rate or extent of the movement of a transcription factor from the cytoplasm to the nucleus.
	GO:0045944	positive regulation of transcription from RNA polymerase II promoter	Any process that activates or increases the frequency, rate or extent of transcription from an RNA polymerase II promoter.
	GO:0032760	positive regulation of tumor necrosis factor production	Any process that activates or increases the frequency, rate, or extent of tumor necrosis factor production.
	GO:0006468	protein phosphorylation	The process of introducing a phosphate group on to a protein.
	GO:0050821	protein stabilization	Any process involved in maintaining the structure and integrity of a protein and preventing it from degradation or aggregation.
	GO:0015031	protein transport	The directed movement of proteins into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
	GO:0090003	regulation of establishment of protein localization to plasma membrane	Any process that modulates the frequency, rate or extent of the directed movement of a protein to a specific location in the plasma membrane.
	GO:0043551	regulation of phosphatidylinositol 3-kinase activity	Any process that modulates the frequency, rate or extent of phosphatidylinositol 3-kinase activity, the catalysis of the transfer of a phosphate group, usually from ATP, to an inositol lipid at the 3' position of the inositol ring.
	GO:0051492	regulation of stress fiber assembly	Any process that modulates the frequency, rate or extent of the assembly of a stress fiber, a bundle of microfilaments and other proteins found in fibroblasts.
	GO:0034976	response to endoplasmic reticulum stress	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stress acting at the endoplasmic reticulum. ER stress usually results from the accumulation of unfolded or misfolded proteins in the ER lumen.
	GO:0007165	signal transduction	The cellular process in which a signal is conveyed to trigger a change in the activity or state of a cell. Signal transduction begins with reception of a signal (e.g. a ligand binding to a receptor or receptor activation by a stimulus such as light), or for signal transduction in the absence of ligand, signal-withdrawal or the activity of a constitutively active receptor. Signal transduction ends with regulation of a downstream cellular process, e.g. regulation of transcription or regulation of a metabolic process. Signal transduction covers signaling from receptors located on the surface of the cell and signaling via molecules located within the cell. For signaling between cells, signal transduction is restricted to events at and within the receiving cell.
	GO:0006810	transport	The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
cellular component
	GO:0005911	cell-cell junction	A cell junction that forms a connection between two or more cells in a multicellular organism; excludes direct cytoplasmic junctions such as ring canals.
	GO:0005801	cis-Golgi network	The network of interconnected tubular and cisternal structures located at the convex side of the Golgi apparatus, which abuts the endoplasmic reticulum.
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
	GO:1990578	perinuclear endoplasmic reticulum membrane	The membrane of the perinuclear endoplasmic reticulum, which is the portion of endoplasmic reticulum, the intracellular network of tubules and cisternae, that occurs near the nucleus.
	GO:0005942	phosphatidylinositol 3-kinase complex	A protein complex capable of phosphatidylinositol 3-kinase activity and containing subunits of any phosphatidylinositol 3-kinase (PI3K) enzyme. These complexes are divided in three classes (called I, II and III) that differ for their presence across taxonomic groups and for the type of their constituents. Catalytic subunits of phosphatidylinositol 3-kinase enzymes are present in all 3 classes; regulatory subunits of phosphatidylinositol 3-kinase enzymes are present in classes I and III; adaptor proteins have been observed in class II complexes and may be present in other classes too.
	GO:0005943	phosphatidylinositol 3-kinase complex, class IA	A class I phosphatidylinositol 3-kinase complex that possesses 1-phosphatidylinositol-4-phosphate 3-kinase activity; comprises a catalytic class IA phosphoinositide 3-kinase (PI3K) subunit and an associated SH2 domain-containing regulatory subunit that is a member of a family of related proteins often called p85 proteins. Through the interaction with the SH2-containing adaptor subunits, Class IA PI3K catalytic subunits are linked to tyrosine kinase signaling pathways.

NMR Structure
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1bfj)

	Sites
(no "Sites" information available for 1bfj)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1bfj)

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ NMR Structure - model 1 PNG format \| NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1bfj
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	P85A_BOVIN \| P23727
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	P85A_BOVIN \| P23727
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	P85A_BOVIN \| P23727	:	1bfi 1oo3 1oo4 1pnj 1qad 2pna 2pnb 2pni 5dxh 5dxu 5t8f

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (1, 1)

Exons (2, 2)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 1)

CATH Domains (1, 1)

Pfam Domains (0, 0)

Gene Ontology (58, 58)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File