|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 1BFA) |
Sites (1, 1)
Asymmetric Unit (1, 1)
|
SS Bonds (5, 5)
Asymmetric/Biological Unit
|
||||||||||||||||||||||||
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1BFA) |
SAPs(SNPs)/Variants (1, 1)
Asymmetric/Biological Unit (1, 1)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
PROSITE Motifs (1, 1)
Asymmetric/Biological Unit (1, 1)
|
||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 1BFA) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:116 aligned with ITRF_MAIZE | P01088 from UniProtKB/Swiss-Prot Length:155 Alignment length:116 42 52 62 72 82 92 102 112 122 132 142 ITRF_MAIZE 33 SCVPGWAIPHNPLPSCRWYVTSRTCGIGPRLPWPELKRRCCRELADIPAYCRCTALSILMDGAIPPGPDAQLEGRLEDLPGCPREVQRGFAATLVTEAECNLATISGVAECPWILG 148 SCOP domains d1bfaa_ A: Hageman factor/amylase inhibitor SCOP domains CATH domains 1bfaA00 A:5-120 Bifunctional Trypsin/Alpha-Amylase Inhibitor CATH domains Pfam domains -------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------A------------------------------- SAPs(SNPs) PROSITE -CEREAL_TRYP_AMYL_INH ------------------------------------------------------------------------------------------- PROSITE Transcript -------------------------------------------------------------------------------------------------------------------- Transcript 1bfa A 5 SCVPGWAIPHNPLPSCRWYVTSRTCGIGPRLPWPELKRRCCRELADIPAYCRCTALSILMDGAIPPGPDAQLEGRLEDLPGCPREVQRGFAATLVTEAECNLATISGVAECPWILG 120 14 24 34 44 54 64 74 84 94 104 114
|
||||||||||||||||||||
SCOP Domains (1, 1)| Asymmetric/Biological Unit |
CATH Domains (1, 1)| Asymmetric/Biological Unit |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 1BFA) |
Gene Ontology (5, 5)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A (ITRF_MAIZE | P01088)
|
||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|