1BA7 - JenaLib

Asym.Unit - manually (Jmol Viewer)

Asymmetric Unit (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Title :   SOYBEAN TRYPSIN INHIBITOR

Authors :   P. De Meester, P. Brick, L. F. Lloyd, D. M. Blow, S. Onesti

Date :   22 Apr 98 (Deposition) - 17 Jun 98 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.50

Chains :   Asym. Unit : A,B
Biol. Unit 1: A  (1x)
Biol. Unit 2: B  (1x)

Keywords :   Serine Protease Inhibitor, Trypsin Inhibitor (Kunitz) (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   P. De Meester, P. Brick, L. F. Lloyd, D. M. Blow, S. Onesti
Structure Of The Kunitz-Type Soybean Trypsin Inhibitor (Sti): Implication For The Interactions Between Members Of The Sti Family And Tissue-Plasminogen Activator.
Acta Crystallogr. , Sect. D V. 54 589 1998
PubMed-ID: 9761854 | Reference-DOI: 10.1107/S0907444997015849
(for further references see the PDB file header)

Molecule 1 - TRYPSIN INHIBITOR (KUNITZ)
	Chains	:	A, B
	Organism Common	:	SOYBEAN
	Organism Scientific	:	GLYCINE MAX
	Organism Taxid	:	3847

		1	2
Asymmetric Unit	:	A	B
Biological Unit 1 (1x)	:	A
Biological Unit 2 (1x)	:		B

Summary Information (see also Sequences/Alignments below)

(no "Ligand,Modified Residues,Ions" information available for 1BA7)

(no "Site" information available for 1BA7)

Asymmetric Unit

No.	Residues
1	A:39	-	A:86
2	A:136	-	A:145
3	B:39	-	B:86
4	B:136	-	B:145

(no "Cis Peptide Bond" information available for 1BA7)

Asymmetric Unit (1, 2)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_ITRA_SOYBN_001 *	G	79	E	ITRA_SOYBN	---	---	A/B	G	55	E
	* ID not provided by source

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 1 (1, 1)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_ITRA_SOYBN_001 *	G	79	E	ITRA_SOYBN	---	---	A	G	55	E
	* ID not provided by source

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 2 (1, 1)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_ITRA_SOYBN_001 *	G	79	E	ITRA_SOYBN	---	---	B	G	55	E
	* ID not provided by source

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Asymmetric Unit (1, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	SOYBEAN_KUNITZ	PS00283	Soybean trypsin inhibitor (Kunitz) protease inhibitors family signature.	ITRA_SOYBN	27-43	2	A:3-19 B:3-19

Biological Unit 1 (1, 1)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	SOYBEAN_KUNITZ	PS00283	Soybean trypsin inhibitor (Kunitz) protease inhibitors family signature.	ITRA_SOYBN	27-43	1	A:3-19 -

Biological Unit 2 (1, 1)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	SOYBEAN_KUNITZ	PS00283	Soybean trypsin inhibitor (Kunitz) protease inhibitors family signature.	ITRA_SOYBN	27-43	1	- B:3-19

(no "Exon" information available for 1BA7)

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:165
 aligned with ITRA_SOYBN | P01070 from UniProtKB/Swiss-Prot  Length:216

    Alignment length:176
                                    34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194      
           ITRA_SOYBN    25 DFVLDNEGNPLENGGTYYILSDITAFGGIRAAPTGNERCPLTVVQSRNELDKGIGTIISSPYRIRFIAEGHPLSLKFDSFAVIMLCVGIPTEWSVVEDLPEGPAVKIGENKDAMDGWFRLERVSDDEFNNYKLVFCPQQAEDDKCGDIGISIDHDDGTRRLVVSKNKPLVVQFQKL 200
               SCOP domains d1ba7a_ A: Soybean trypsin inhibitor                                                                                                                                             SCOP domains
               CATH domains 1ba7A00 A:1-176  [code=2.80.10.50, no name defined]                                                                                                                              CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..............eeeeeee.......eeee.........eeee..........eeee..............eeee......hhh.......eee.......eee.........eeeeeee.-----..eeeeeee.------...eeeee......eeeee.......eeeee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------E------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --SOYBEAN_KUNITZ   ------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1ba7 A   1 DFVLDNEGNPLENGGTYYILSDITAFGGIRAAPTGNERCPLTVVQSRNELDKGIGTIISSPYRIRFIAEGHPLSLKFDSFAVIMLCVGIPTEWSVVEDLPEGPAVKIGENKDAMDGWFRLERV-----NNYKLVFCPQ------CGDIGISIDHDDGTRRLVVSKNKPLVVQFQKL 176
                                    10        20        30        40        50        60        70        80        90       100       110       120  |    130       | -    |  150       160       170      
                                                                                                                                                    123   129      138    145

Chain B from PDB  Type:PROTEIN  Length:169
 aligned with ITRA_SOYBN | P01070 from UniProtKB/Swiss-Prot  Length:216

    Alignment length:176
                                    34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194      
           ITRA_SOYBN    25 DFVLDNEGNPLENGGTYYILSDITAFGGIRAAPTGNERCPLTVVQSRNELDKGIGTIISSPYRIRFIAEGHPLSLKFDSFAVIMLCVGIPTEWSVVEDLPEGPAVKIGENKDAMDGWFRLERVSDDEFNNYKLVFCPQQAEDDKCGDIGISIDHDDGTRRLVVSKNKPLVVQFQKL 200
               SCOP domains d1ba7b_ B: Soybean trypsin inhibitor                                                                                                                                             SCOP domains
               CATH domains 1ba7B00 B:1-176  [code=2.80.10.50, no name defined]                                                                                                                              CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..............eeeeeee.......eeee.........eeee..........eeee..............eeee......hhh.......eee.......eee.........eeeeeee..---...eeeeeee.----..eeeeeeee......eeeee.......eeeee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------E------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --SOYBEAN_KUNITZ   ------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1ba7 B   1 DFVLDNEGNPLENGGTYYILSDITAFGGIRAAPTGNERCPLTVVQSRNELDKGIGTIISSPYRIRFIAEGHPLSLKFDSFAVIMLCVGIPTEWSVVEDLPEGPAVKIGENKDAMDGWFRLERVS---FNNYKLVFCPQ----DKCGDIGISIDHDDGTRRLVVSKNKPLVVQFQKL 176
                                    10        20        30        40        50        60        70        80        90       100       110       120   |   130       | -  |    150       160       170      
                                                                                                                                                     124 128       138  143

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: All beta proteins (24004)

Fold: beta-Trefoil (385)

Superfamily: STI-like (91)

Family: Kunitz (STI) inhibitors (29)

Protein domain: Soybean trypsin inhibitor (4)

Soybean (Glycine max) [TaxId: 3847] (4)

1a	d1ba7a_	A:
1b	d1ba7b_	B:

Asymmetric Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Mainly Beta (13760)

Architecture: Trefoil (289)

Topology: Trefoil (Acidic Fibroblast Growth Factor, subunit A) (289)

Homologous Superfamily: [code=2.80.10.50, no name defined] (289)

Soybean (Glycine max) (2)

1a	1ba7A00	A:1-176
1b	1ba7B00	B:1-176

(no "Pfam Domain" information available for 1BA7)

Asymmetric Unit(hide GO term definitions)

Chain A,B (ITRA_SOYBN | P01070)

molecular function
	GO:0004866	endopeptidase inhibitor activity	Stops, prevents or reduces the activity of an endopeptidase, any enzyme that hydrolyzes nonterminal peptide bonds in polypeptides.
	GO:0030414	peptidase inhibitor activity	Stops, prevents or reduces the activity of a peptidase, any enzyme that catalyzes the hydrolysis peptide bonds.
	GO:0004867	serine-type endopeptidase inhibitor activity	Stops, prevents or reduces the activity of serine-type endopeptidases, enzymes that catalyze the hydrolysis of nonterminal peptide bonds in a polypeptide chain; a serine residue (and a histidine residue) are at the active center of the enzyme.
biological process
	GO:0010951	negative regulation of endopeptidase activity	Any process that decreases the frequency, rate or extent of endopeptidase activity, the endohydrolysis of peptide bonds within proteins.
	GO:0010466	negative regulation of peptidase activity	Any process that stops or reduces the rate of peptidase activity, the hydrolysis of peptide bonds within proteins.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1ba7)

	Sites
(no "Sites" information available for 1ba7)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1ba7)

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1ba7
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	ITRA_SOYBN \| P01070
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	ITRA_SOYBN \| P01070
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	ITRA_SOYBN \| P01070	:	1avu 1avw 1avx

(no "Related Entries Specified in the PDB File" available for 1BA7)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (4, 4)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (1, 2)

PROSITE Motifs (1, 2)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 2)

CATH Domains (1, 2)

Pfam Domains (0, 0)

Gene Ontology (5, 5)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File