Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  STRUCTURE-BASED IDENTIFICATION OF THE BIOCHEMICAL FUNCTION OF A HYPOTHETICAL PROTEIN FROM METHANOCOCCUS JANNASCHII:MJ0226
 
Authors :  K. Y. Hwang, J. H. Chung, Y. S. Han, S. H. Kim, Y. Cho
Date :  27 Jan 99  (Deposition) - 28 Jan 00  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.20
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Structural Genomics, Pyrophosphatase, Hyperthermal Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  K. Y. Hwang, J. H. Chung, S. H. Kim, Y. S. Han, Y. Cho
Structure-Based Identification Of A Novel Ntpase From Methanococcus Jannaschii.
Nat. Struct. Biol. V. 6 691 1999
PubMed-ID: 10404228  |  Reference-DOI: 10.1038/10745
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - PYROPHOSPHATASE
    ChainsA, B
    Organism ScientificMETHANOCALDOCOCCUS JANNASCHII
    Organism Taxid2190

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1B78)

(-) Sites  (0, 0)

(no "Site" information available for 1B78)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1B78)

(-) Cis Peptide Bonds  (2, 2)

Asymmetric/Biological Unit
No.Residues
1Phe A:84 -Pro A:85
2Phe B:84 -Pro B:85

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1B78)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1B78)

(-) Exons   (0, 0)

(no "Exon" information available for 1B78)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:184
 aligned with IXTPA_METJA | Q57679 from UniProtKB/Swiss-Prot  Length:185

    Alignment length:184
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181    
          IXTPA_METJA     2 KIYFATGNPNKIKEANIILKDLKDVEIEQIKISYPEIQGTLEEVAEFGAKWVYNILKKPVIVEDSGFFVEALNGFPGTYSKFVQETIGNEGILKLLEGKDNRNAYFKTVIGYCDENGVRLFKGIVKGRVSEEIRSKGYGFAYDSIFIPEEEERTFAEMTTEEKSQISHRKKAFEEFKKFLLDRI 185
               SCOP domains d1b78a_ A: XTP pyrophosphatase                                                                                                                                                           SCOP domains
               CATH domains 1b78A00 A:10-193  [code=3.90.950.10, no name defined]                                                                                                                                    CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeee...hhhhhhhhhh........eeee..........hhhhhhhhhhhhhhhh...eeeeeeeeeehhh....hhhhhhhhhh.hhhhhhhhh......eeeeeeeeeeee..eeeeeeeeeeeee...........hhhh.eee......hhh..hhhh....hhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1b78 A  10 KIYFATGNPNKIKEANIILKDLKDVEIEQIKISYPEIQGTLEEVAEFGAKWVYNILKKPVIVEDSGFFVEALNGFPGTYSKFVQETIGNEGILKLLEGKDNRNAYFKTVIGYCDENGVRLFKGIVKGRVSEEIRSKGYGFAYDSIFIPEEEERTFAEMTTEEKSQISHRKKAFEEFKKFLLDRI 193
                                    19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189    

Chain B from PDB  Type:PROTEIN  Length:184
 aligned with IXTPA_METJA | Q57679 from UniProtKB/Swiss-Prot  Length:185

    Alignment length:184
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181    
          IXTPA_METJA     2 KIYFATGNPNKIKEANIILKDLKDVEIEQIKISYPEIQGTLEEVAEFGAKWVYNILKKPVIVEDSGFFVEALNGFPGTYSKFVQETIGNEGILKLLEGKDNRNAYFKTVIGYCDENGVRLFKGIVKGRVSEEIRSKGYGFAYDSIFIPEEEERTFAEMTTEEKSQISHRKKAFEEFKKFLLDRI 185
               SCOP domains d1b78b_ B: XTP pyrophosphatase                                                                                                                                                           SCOP domains
               CATH domains 1b78B00 B:10-193  [code=3.90.950.10, no name defined]                                                                                                                                    CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
     Sec.struct. author (1) .eeee...hhhhhhhhhh........eeee..........hhhhhhhhhhhhhhhh...eeeeeeeeeehhh..--hhhhhhhhhh.hhhhhhhhh......eeeeeeeeeeee..eeeeeeeeeeeee...........hhhhheee......hhh...hhh....hhhhhhhhhhhhhhh.. Sec.struct. author (1)
     Sec.struct. author (2) --------------------------------------------------------------------------eee----------------------------------------------------------------------------------------------------------- Sec.struct. author (2)
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1b78 B  10 KIYFATGNPNKIKEANIILKDLKDVEIEQIKISYPEIQGTLEEVAEFGAKWVYNILKKPVIVEDSGFFVEALNGFPGTYSKFVQETIGNEGILKLLEGKDNRNAYFKTVIGYCDENGVRLFKGIVKGRVSEEIRSKGYGFAYDSIFIPEEEERTFAEMTTEEKSQISHRKKAFEEFKKFLLDRI 193
                                    19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189    

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric/Biological Unit

(-) CATH Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1B78)

(-) Gene Ontology  (8, 8)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B   (IXTPA_METJA | Q57679)
molecular function
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0017111    nucleoside-triphosphatase activity    Catalysis of the reaction: a nucleoside triphosphate + H2O = nucleoside diphosphate + phosphate.
    GO:0047429    nucleoside-triphosphate diphosphatase activity    Catalysis of the reaction: H2O + a nucleoside triphosphate = diphosphate + a nucleotide.
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
biological process
    GO:0009143    nucleoside triphosphate catabolic process    The chemical reactions and pathways resulting in the breakdown of a nucleoside triphosphate, a compound consisting of a nucleobase linked to a deoxyribose or ribose sugar esterified with triphosphate on the sugar.
    GO:0009117    nucleotide metabolic process    The chemical reactions and pathways involving a nucleotide, a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the glycose moiety; may be mono-, di- or triphosphate; this definition includes cyclic nucleotides (nucleoside cyclic phosphates).
    GO:0006163    purine nucleotide metabolic process    The chemical reactions and pathways involving a purine nucleotide, a compound consisting of nucleoside (a purine base linked to a deoxyribose or ribose sugar) esterified with a phosphate group at either the 3' or 5'-hydroxyl group of the sugar.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1b78)
 
  Sites
(no "Sites" information available for 1b78)
 
  Cis Peptide Bonds
    Phe A:84 - Pro A:85   [ RasMol ]  
    Phe B:84 - Pro B:85   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1b78
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  IXTPA_METJA | Q57679
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  IXTPA_METJA | Q57679
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        IXTPA_METJA | Q576792mjp

(-) Related Entries Specified in the PDB File

2mjp PYROPHOSPHATASE + 5'-ADENYLY-IMIDO-TRIPHOSPHATE