Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  STRUCTURE OF GLUTATHIONE S-TRANSFERASE-I BOUND WITH THE LIGAND LACTOYLGLUTATHIONE
 
Authors :  T. Neuefeind, R. Huber, H. Dasenbrock, L. Prade, B. Bieseler
Date :  15 Oct 97  (Deposition) - 28 Oct 98  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.50
Chains :  Asym./Biol. Unit :  A,B,C,D
Keywords :  Transferase, Herbicide Detoxification, Transferase-Transferase Inhibitor Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  T. Neuefeind, R. Huber, H. Dasenbrock, L. Prade, B. Bieseler
Crystal Structure Of Herbicide-Detoxifying Maize Glutathion S-Transferase-I In Complex With Lactoylglutathione: Evidenc For An Induced-Fit Mechanism.
J. Mol. Biol. V. 274 446 1997
PubMed-ID: 9417926  |  Reference-DOI: 10.1006/JMBI.1997.1402

(-) Compounds

Molecule 1 - GLUTATHIONE S-TRANSFERASE I
    Chains: A, B
    EC Number: 2.5.1.18
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PET3A
    Expression System Taxid: 562
    Organism Scientific: ZEA MAYS
    Organism Taxid: 4577
    Variant: MUTIN
 
Molecule 2 - LACTOYLGLUTATHIONE
    Chains: C, D

 Structural Features

(-) Chains, Units

  1234
Asymmetric/Biological Unit : ABCD

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 4)

Asymmetric/Biological Unit (2, 4)
No.NameCountTypeFull Name
1CYW2Mod. Amino AcidS-[(2R)-2-HYDROXYPROPANOYL]-L-CYSTEINE
2GGL2Mod. Amino AcidL-GLUTAMIC ACID

(-) Sites  (2, 2)

Asymmetric Unit (2, 2)
No.NameEvidenceResiduesDescription
1AC1SOFTWARESER A:11 , ASN A:13 , PHE A:35 , HIS A:40 , LYS A:41 , GLN A:53 , VAL A:54 , PRO A:55 , GLU A:66 , SER A:67 , ARG A:68 , HOH A:230 , HOH C:6 , HOH C:10 , HOH C:57BINDING SITE FOR CHAIN C OF LACTOYLGLUTATHIONE
2AC2SOFTWARESER B:11 , ASN B:13 , PHE B:35 , HIS B:40 , LYS B:41 , GLN B:53 , VAL B:54 , PRO B:55 , GLU B:66 , SER B:67 , HOH B:272 , HOH D:145 , HOH D:163 , HOH D:237BINDING SITE FOR CHAIN D OF LACTOYLGLUTATHIONE

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1AXD)

(-) Cis Peptide Bonds  (2, 2)

Asymmetric/Biological Unit
No.Residues
1Val A:54 -Pro A:55
2Val B:54 -Pro B:55

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1AXD)

(-) PROSITE Motifs  (2, 4)

Asymmetric/Biological Unit (2, 4)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1GST_NTERPS50404 Soluble glutathione S-transferase N-terminal domain profile.GSTF1_MAIZE2-83
 		  2A:1-82
B:1-82
2GST_CTERPS50405 Soluble glutathione S-transferase C-terminal domain profile.GSTF1_MAIZE88-214
 		  2A:88-210
B:86-210

(-) Exons   (0, 0)

(no "Exon" information available for 1AXD)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:209
 aligned with GSTF1_MAIZE | P12653 from UniProtKB/Swiss-Prot  Length:214

    Alignment length:209
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201         
          GSTF1_MAIZE     2 APMKLYGAVMSWNLTRCATALEEAGSDYEIVPINFATAEHKSPEHLVRNPFGQVPALQDGDLYLFESRAICKYAARKNKPELLREGNLEEAAMVDVWIEVEANQYTAALNPILFQVLISPMLGGTTDQKVVDENLEKLKKVLEVYEARLTKCKYLAGDFLSLADLNHVSVTLCLFATPYASVLDAYPHVKAWWSGLMERPSVQKVAALM 210
               SCOP domains d1axda2 A:1-80 Class phi GST                                                    d1axda1 A:81-210 Class phi GST                                                                                                    SCOP domains
               CATH domains -1axdA01 A:2-83 Glutaredoxin                                                       1axdA02 A:84-207  [code=1.20.1050.10, no name defined]                                                                     --- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeee.......hhhhhhhhhhh...eeee.......hhh.hhhh.........eeee..eeee.hhhhhhhhhhhh.hhhh....hhhhhhhhhhhhhhhh.hhhhhhhhhhhh.hhhhh.....hhhhhhhhhhhhhhhhhhhhhhhh..........hhhhhhhhhhhhhhh.hhhhhhhh.hhhhhhhhhhhh.hhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE GST_NTER  PDB: A:1-82 UniProt: 2-83                                               ----GST_CTER  PDB: A:88-210 UniProt: 88-214                                                                                     PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1axd A   1 APMKLYGAVMSWNLTRCATALEEAGSDYEIVPINFATAEHKSPEHLVRNPFGQVPALQDGDLYLFESRAICKYAARKNKPELLREGNLEEAAMVDVWIEVEANQYTAALNPILFQVLISPMLGGTTDQKVVDENLEKLKKVLEVYEARLTKCKYLAGDFLSLADLNHVSVTLCLFATPYASVLDAYPHVKAWWSGLMERPSVQKVAALM 210
                                    10        20        30        40        50        60        70        80     || 91       101       111       121       131       141       151       161       171       181       191       201         
                                                                                                                86|                                                                                                                          
                                                                                                                 88                                                                                                                          


Chain B from PDB  Type:PROTEIN  Length:209
 aligned with GSTF1_MAIZE | P12653 from UniProtKB/Swiss-Prot  Length:214

    Alignment length:209
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201         
          GSTF1_MAIZE     2 APMKLYGAVMSWNLTRCATALEEAGSDYEIVPINFATAEHKSPEHLVRNPFGQVPALQDGDLYLFESRAICKYAARKNKPELLREGNLEEAAMVDVWIEVEANQYTAALNPILFQVLISPMLGGTTDQKVVDENLEKLKKVLEVYEARLTKCKYLAGDFLSLADLNHVSVTLCLFATPYASVLDAYPHVKAWWSGLMERPSVQKVAALM 210
               SCOP domains d1axdb2 B:1-80 Class phi GST                                                    d1axdb1 B:81-210 Class phi GST                                                                                                    SCOP domains
               CATH domains -1axdB01 B:2-83 Glutaredoxin                                                       1axdB02 B:84-207  [code=1.20.1050.10, no name defined]                                                                     --- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeee.....hhhhhhhhhhhh....eeee...hhh.hhh...hhh........eeee..eeee.hhhhhhhhhhhh.hhh.....hhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhh..........hhhhhhhhhhhhhhh.hhhhhhhh.hhhhhhhhhhhh.hhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE GST_NTER  PDB: B:1-82 UniProt: 2-83                                               ----GST_CTER  PDB: B:86-210 UniProt: 88-214                                                                                     PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1axd B   1 APMKLYGAVMSWNLTRCATALEEAGSDYEIVPINFATAEHKSPEHLVRNPFGQVPALQDGDLYLFESRAICKYAARKNKPELLREGNLEEAAMVDVWIEVEANQYTAALNPILFQVLISPMLGGTTDQKVVDENLEKLKKVLEVYEARLTKCKYLAGDFLSLADLNHVSVTLCLFATPYASVLDAYPHVKAWWSGLMERPSVQKVAALM 210
                                    10        20        30        40        50        60        70        80     |  91       101       111       121       131       141       151       161       171       181       191       201         
                                                                                                               85A 88|                                                                                                                       
                                                                                                                    91                                                                                                                       


Chain C from PDB  Type:PROTEIN  Length:3
                                   
               SCOP domains --- SCOP domains
               CATH domains --- CATH domains
               Pfam domains --- Pfam domains
         Sec.struct. author ... Sec.struct. author
                 SAPs(SNPs) --- SAPs(SNPs)
                    PROSITE --- PROSITE
                 Transcript --- Transcript
                 1axd C   1 xcG   3
                            || 
                            1-GGL
                             2-CYW


Chain D from PDB  Type:PROTEIN  Length:3
                                   
               SCOP domains --- SCOP domains
               CATH domains --- CATH domains
               Pfam domains --- Pfam domains
         Sec.struct. author ... Sec.struct. author
                 SAPs(SNPs) --- SAPs(SNPs)
                    PROSITE --- PROSITE
                 Transcript --- Transcript
                 1axd D   1 xcG   3
                            || 
                            || 
                            1-GGL
                             2-CYW
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (2, 4)

Asymmetric/Biological Unit
(-)
Class: All alpha proteins (14657)
(-)
Class: Alpha and beta proteins (a/b) (23833)

(-) CATH Domains  (2, 4)

Asymmetric/Biological Unit
(-)
Class: Alpha Beta (26913)
(-)
Class: Mainly Alpha (13335)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1AXD)

(-) Gene Ontology  (2, 2)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B   (GSTF1_MAIZE | P12653)
molecular function
    GO:0004364    glutathione transferase activity    Catalysis of the reaction: R-X + glutathione = H-X + R-S-glutathione. R may be an aliphatic, aromatic or heterocyclic group; X may be a sulfate, nitrile or halide group.
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    CYW  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    GGL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Val A:54 - Pro A:55   [ RasMol ]  
    Val B:54 - Pro B:55   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1axd
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  GSTF1_MAIZE | P12653
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  2.5.1.18
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  GSTF1_MAIZE | P12653
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        GSTF1_MAIZE | P12653: 1bye

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1AXD)