|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric Unit (1, 2)
|
Asymmetric Unit (2, 2)
|
(no "SS Bond" information available for 1AW8) |
(no "Cis Peptide Bond" information available for 1AW8) |
(no "SAP(SNP)/Variant" information available for 1AW8) |
(no "PROSITE Motif" information available for 1AW8) |
(no "Exon" information available for 1AW8) |
Asymmetric UnitChain A from PDB Type:PROTEIN Length:24 aligned with PAND_ECOLI | P0A790 from UniProtKB/Swiss-Prot Length:126 Alignment length:24 10 20 PAND_ECOLI 1 MIRTMLQGKLHRVKVTHADLHYEG 24 SCOP domains d1aw8.1 A:,B: SCOP domains CATH domains ------------------------ CATH domains Pfam domains ------------------------ Pfam domains SAPs(SNPs) ------------------------ SAPs(SNPs) PROSITE ------------------------ PROSITE Transcript ------------------------ Transcript 1aw8 A 1 MIRTMLQGKLHRVKVTHADLHYEG 24 10 20 Chain B from PDB Type:PROTEIN Length:92 aligned with PAND_ECOLI | P0A790 from UniProtKB/Swiss-Prot Length:126 Alignment length:92 33 43 53 63 73 83 93 103 113 PAND_ECOLI 24 GSCAIDQDFLDAAGILENEAIDIWNVTNGKRFSTYAIAAERGSRIISVNGAAAHCASVGDIVIIASFVTMPDEEARTWRPNVAYFEGDNEMK 115 SCOP domains 11aw8.1 A:,B: Pyruvoyl dependent aspartate decarboxylase, ADC SCOP domains CATH domains 11aw8B00 B:25-115 [code=2.40.40.20, no name defined] CATH domains Pfam domains -------------------------------------------------------------------------------------------- Pfam domains Chain D from PDB Type:PROTEIN Length:24 aligned with PAND_ECOLI | P0A790 from UniProtKB/Swiss-Prot Length:126 Alignment length:24 10 20 PAND_ECOLI 1 MIRTMLQGKLHRVKVTHADLHYEG 24 SCOP domains d1aw8.2 D:,E: SCOP domains CATH domains ------------------------ CATH domains Pfam domains ------------------------ Pfam domains SAPs(SNPs) ------------------------ SAPs(SNPs) PROSITE ------------------------ PROSITE Transcript ------------------------ Transcript 1aw8 D 1 MIRTMLQGKLHRVKVTHADLHYEG 24 10 20 Chain E from PDB Type:PROTEIN Length:91 aligned with PAND_ECOLI | P0A790 from UniProtKB/Swiss-Prot Length:126 Alignment length:91 34 44 54 64 74 84 94 104 114 PAND_ECOLI 25 SCAIDQDFLDAAGILENEAIDIWNVTNGKRFSTYAIAAERGSRIISVNGAAAHCASVGDIVIIASFVTMPDEEARTWRPNVAYFEGDNEMK 115 SCOP domains d1aw8.2 D:,E: Pyruvoyl dependent aspartate decarboxylase, ADC SCOP domains CATH domains -1aw8E00 E:26-115 [code=2.40.40.20, no name defined] CATH domains Pfam domains ------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------------- PROSITE Transcript ------------------------------------------------------------------------------------------- Transcript 1aw8 E 25 xCAIDQDFLDAAGILENEAIDIWNVTNGKRFSTYAIAAERGSRIISVNGAAAHCASVGDIVIIASFVTMPDEEARTWRPNVAYFEGDNEMK 115 | 34 44 54 64 74 84 94 104 114 25-PYR
|
Asymmetric Unit |
Asymmetric Unit |
(no "Pfam Domain" information available for 1AW8) |
Asymmetric Unit(hide GO term definitions) Chain A,B,D,E (PAND_ECOLI | P0A790)
|
|
|
|
|
|
|