Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit - manually
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit - manually
Asym./Biol. Unit - manually  (Jmol Viewer)
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  PATHOGENESIS-RELATED PROTEIN 5D FROM NICOTIANA TABACUM
 
Authors :  H. Koiwa, H. Kato, T. Nakatsu, J. Oda, Y. Yamada, F. Sato
Date :  29 Aug 97  (Deposition) - 04 Mar 98  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.80
Chains :  Asym./Biol. Unit :  A
Keywords :  Antifungal Protein, Pathogenesis-Related Protein, Pr-5D, Osmotin, Thaumatin-Like Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  H. Koiwa, H. Kato, T. Nakatsu, J. Oda, Y. Yamada, F. Sato
Crystal Structure Of Tobacco Pr-5D Protein At 1. 8 A Resolution Reveals A Conserved Acidic Cleft Structure In Antifungal Thaumatin-Like Proteins.
J. Mol. Biol. V. 286 1137 1999
PubMed-ID: 10047487  |  Reference-DOI: 10.1006/JMBI.1998.2540
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - PR-5D
    Cell: CULTURED CELL
    Cellular Location: VACUOLE
    Chains: A
    Organism Common: COMMON TOBACCO
    Organism Scientific: NICOTIANA TABACUM
    Organism Taxid: 4097
    Strain: SAMSUN NN
    Synonym: OSMOTIN-LIKE PROTEIN

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit : A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1AUN)

(-) Sites  (0, 0)

(no "Site" information available for 1AUN)

(-) SS Bonds  (8, 8)

Asymmetric/Biological Unit
No.Residues
1A:10 -A:205
2A:52 -A:62
3A:67 -A:73
4A:121 -A:193
5A:126 -A:176
6A:134 -A:144
7A:148 -A:157
8A:158 -A:163

(-) Cis Peptide Bonds  (2, 2)

Asymmetric/Biological Unit
No.Residues
1Thr A:19 -Pro A:20
2Pro A:79 -Pro A:80

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1AUN)

(-) PROSITE Motifs  (2, 2)

Asymmetric/Biological Unit (2, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1THAUMATIN_2PS51367 Thaumatin family profile.OLPA_TOBAC22-229  1A:1-208
2THAUMATIN_1PS00316 Thaumatin family signature.OLPA_TOBAC79-94  1A:58-73

(-) Exons   (0, 0)

(no "Exon" information available for 1AUN)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:208
 aligned with OLPA_TOBAC | P25871 from UniProtKB/Swiss-Prot  Length:251

    Alignment length:208
                                    31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221        
           OLPA_TOBAC    22 SGVFEVHNNCPYTVWAAATPVGGGRRLERGQSWWFWAPPGTKMARIWGRTNCNFDGAGRGWCQTGDCGGVLECKGWGKPPNTLAEYALNQFSNLDFWDISVIDGFNIPMSFGPTKPGPGKCHGIQCTANINGECPGSLRVPGGCNNPCTTFGGQQYCCTQGPCGPTELSRWFKQRCPDAYSYPQDDPTSTFTCTSWTTDYKVMFCPYG 229
               SCOP domains d1auna_ A: Pathogenesis-related protein 5d                                                                                                                                                                       SCOP domains
               CATH domains 1aunA00 A:1-208 Thaumatin                                                                                                                                                                                        CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeee.....eeeeee...eeeee....eeeee.......eeeeeee.eee.....eee....................eeeee...hhheeeeeee........eeeee..........eee...hhhh.............hhhh...hhhh.........hhhhhhhhh...............eeee.....eeeee.... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) THAUMATIN_2  PDB: A:1-208 UniProt: 22-229                                                                                                                                                                        PROSITE (1)
                PROSITE (2) ---------------------------------------------------------THAUMATIN_1     --------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1aun A   1 SGVFEVHNNCPYTVWAAATPVGGGRRLERGQSWWFWAPPGTKMARIWGRTNCNFDGAGRGWCQTGDCGGVLECKGWGKPPNTLAEYALNQFSNLDFWDISVIDGFNIPMSFGPTKPGPGKCHGIQCTANINGECPGSLRVPGGCNNPCTTFGGQQYCCTQGPCGPTELSRWFKQRCPDAYSYPQDDPTSTFTCTSWTTDYKVMFCPYG 208
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

Asymmetric/Biological Unit
(-)
Class: All beta proteins (24004)

(-) CATH Domains  (1, 1)

Asymmetric/Biological Unit
(-)
Class: Mainly Beta (13760)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1AUN)

(-) Gene Ontology  (2, 2)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A   (OLPA_TOBAC | P25871)
biological process
    GO:0006952    defense response    Reactions, triggered in response to the presence of a foreign body or the occurrence of an injury, which result in restriction of damage to the organism attacked or prevention/recovery from the infection caused by the attack.
    GO:0009607    response to biotic stimulus    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a biotic stimulus, a stimulus caused or produced by a living organism.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1aun)
 
  Sites
(no "Sites" information available for 1aun)
 
  Cis Peptide Bonds
    Pro A:79 - Pro A:80   [ RasMol ]  
    Thr A:19 - Pro A:20   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1aun
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  OLPA_TOBAC | P25871
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  OLPA_TOBAC | P25871
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1AUN)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1AUN)