1AJ5 - JenaLib

Biol.Unit 1 - manually (Jmol Viewer)

Asymmetric Unit (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Title :   CALPAIN DOMAIN VI APO

Authors :   M. Cygler, P. Grochulski, H. Blanchard

Date :   15 May 97 (Deposition) - 20 May 98 (Release) - 02 May 12 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.30

Chains :   Asym. Unit : A,B
Biol. Unit 1: A  (2x)
Biol. Unit 2: B  (2x)

Keywords :   Calcium-Binding Protein, Calcium-Dependent Protease, Apo Form, Small Subunit (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   H. Blanchard, P. Grochulski, Y. Li, J. S. Arthur, P. L. Davies, J. S. Elce, M. Cygler
Structure Of A Calpain Ca(2+)-Binding Domain Reveals A Nove Ef-Hand And Ca(2+)-Induced Conformational Changes.
Nat. Struct. Biol. V. 4 532 1997
PubMed-ID: 9228945 | Reference-DOI: 10.1038/NSB0797-532
(for further references see the PDB file header)

Molecule 1 - CALPAIN
	Cell Line	:	BL21
	Chains	:	A, B
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI BL21(DE3)
	Expression System Plasmid	:	PT7-7F-21K
	Expression System Strain	:	BL21 (DE3)
	Expression System Taxid	:	469008
	Expression System Vector	:	PT7
	Fragment	:	SMALL REGULATORY SUBUNIT, DOMAIN VI, MET 87 - SER 270
	Gene	:	CAPN4
	Organ	:	LIVER
	Organism Common	:	NORWAY RAT
	Organism Scientific	:	RATTUS NORVEGICUS
	Organism Taxid	:	10116
	Strain	:	BL21 (DE3)

		1	2
Asymmetric Unit	:	A	B
Biological Unit 1 (2x)	:	A
Biological Unit 2 (2x)	:		B

Summary Information (see also Sequences/Alignments below)

(no "Ligand,Modified Residues,Ions" information available for 1AJ5)

(no "Site" information available for 1AJ5)

(no "SS Bond" information available for 1AJ5)

(no "Cis Peptide Bond" information available for 1AJ5)

(no "SAP(SNP)/Variant" information available for 1AJ5)

Asymmetric Unit (2, 10)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	EF_HAND_1	PS00018	EF-hand calcium-binding domain.	CPNS1_RAT	154-166 184-196	4	A:154-166 B:154-166 A:184-196 B:184-196
2	EF_HAND_2	PS50222	EF-hand calcium-binding domain profile.	CPNS1_RAT	171-206 141-169 236-270	6	A:171-206 B:171-206 A:141-169 B:141-169 A:236-270 B:236-270

Biological Unit 1 (2, 10)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	EF_HAND_1	PS00018	EF-hand calcium-binding domain.	CPNS1_RAT	154-166 184-196	4	A:154-166 - A:184-196 -
2	EF_HAND_2	PS50222	EF-hand calcium-binding domain profile.	CPNS1_RAT	171-206 141-169 236-270	6	A:171-206 - A:141-169 - A:236-270 -

Biological Unit 2 (2, 10)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	EF_HAND_1	PS00018	EF-hand calcium-binding domain.	CPNS1_RAT	154-166 184-196	4	- B:154-166 - B:184-196
2	EF_HAND_2	PS50222	EF-hand calcium-binding domain profile.	CPNS1_RAT	171-206 141-169 236-270	6	- B:171-206 - B:141-169 - B:236-270

(no "Exon" information available for 1AJ5)

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:173
 aligned with CPNS1_RAT | Q64537 from UniProtKB/Swiss-Prot  Length:270

    Alignment length:173
                                   107       117       127       137       147       157       167       177       187       197       207       217       227       237       247       257       267   
            CPNS1_RAT    98 EEERQFRKLFVQLAGDDMEVSATELMNILNKVVTRHPDLKTDGFGIDTCRSMVAVMDSDTTGKLGFEEFKYLWNNIKKWQGIYKRFDTDRSGTIGSNELPGAFEAAGFHLNQHIYSMIIRRYSDETGNMDFDNFISCLVRLDAMFRAFRSLDKNGTGQIQVNIQEWLQLTMYS 270
               SCOP domains d1aj5a_ A: Calpain small (regulatory) subunit (domain VI)                                                                                                                     SCOP domains
               CATH domains 1aj5A00 A:98-270 EF-hand                                                                                                                                                      CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhh.ee.hhhhhhhhhhhh............hhhhhhhhhhh.......eehhhhhhhhhhhhhhhhhhhhh............hhhhhhhh.....hhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhh..........hhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) --------------------------------------------------------EF_HAND_1    -----------------EF_HAND_1    ---------------------------------------EF_HAND_2  PDB: A:236-270           PROSITE (1)
                PROSITE (2) -------------------------------------------EF_HAND_2  PDB: A:141-169    -EF_HAND_2  PDB: A:171-206           ---------------------------------------------------------------- PROSITE (2)
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1aj5 A  98 EEERQFRKLFVQLAGDDMEVSATELMNILNKVVTRHPDLKTDGFGIDTCRSMVAVMDSDTTGKLGFEEFKYLWNNIKKWQGIYKRFDTDRSGTIGSNELPGAFEAAGFHLNQHIYSMIIRRYSDETGNMDFDNFISCLVRLDAMFRAFRSLDKNGTGQIQVNIQEWLQLTMYS 270
                                   107       117       127       137       147       157       167       177       187       197       207       217       227       237       247       257       267

Chain B from PDB  Type:PROTEIN  Length:173
 aligned with CPNS1_RAT | Q64537 from UniProtKB/Swiss-Prot  Length:270

    Alignment length:173
                                   107       117       127       137       147       157       167       177       187       197       207       217       227       237       247       257       267   
            CPNS1_RAT    98 EEERQFRKLFVQLAGDDMEVSATELMNILNKVVTRHPDLKTDGFGIDTCRSMVAVMDSDTTGKLGFEEFKYLWNNIKKWQGIYKRFDTDRSGTIGSNELPGAFEAAGFHLNQHIYSMIIRRYSDETGNMDFDNFISCLVRLDAMFRAFRSLDKNGTGQIQVNIQEWLQLTMYS 270
               SCOP domains d1aj5b_ B: Calpain small (regulatory) subunit (domain VI)                                                                                                                     SCOP domains
               CATH domains 1aj5B00 B:98-270 EF-hand                                                                                                                                                      CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhh.ee.hhhhhhhhhhhh............hhhhhhhhhhh.......eehhhhhhhhhhhhhhhhhhhhh.........hhhhhhhhhhh.....hhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhh...........hhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) --------------------------------------------------------EF_HAND_1    -----------------EF_HAND_1    ---------------------------------------EF_HAND_2  PDB: B:236-270           PROSITE (1)
                PROSITE (2) -------------------------------------------EF_HAND_2  PDB: B:141-169    -EF_HAND_2  PDB: B:171-206           ---------------------------------------------------------------- PROSITE (2)
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1aj5 B  98 EEERQFRKLFVQLAGDDMEVSATELMNILNKVVTRHPDLKTDGFGIDTCRSMVAVMDSDTTGKLGFEEFKYLWNNIKKWQGIYKRFDTDRSGTIGSNELPGAFEAAGFHLNQHIYSMIIRRYSDETGNMDFDNFISCLVRLDAMFRAFRSLDKNGTGQIQVNIQEWLQLTMYS 270
                                   107       117       127       137       147       157       167       177       187       197       207       217       227       237       247       257       267

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: All alpha proteins (14657)

Fold: EF Hand-like (739)

Superfamily: EF-hand (657)

Family: Penta-EF-hand proteins (30)

Protein domain: Calpain small (regulatory) subunit (domain VI) (16)

Norway rat (Rattus norvegicus) [TaxId: 10116] (8)

1a	d1aj5a_	A:
1b	d1aj5b_	B:

Asymmetric Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Mainly Alpha (13335)

Architecture: Orthogonal Bundle (10391)

Topology: Recoverin; domain 1 (474)

Homologous Superfamily: EF-hand (412)

Norway rat (Rattus norvegicus) (37)

1a	1aj5A00	A:98-270
1b	1aj5B00	B:98-270

(no "Pfam Domain" information available for 1AJ5)

Asymmetric Unit(hide GO term definitions)

Chain A,B (CPNS1_RAT | Q64537)

molecular function
	GO:0005509	calcium ion binding	Interacting selectively and non-covalently with calcium ions (Ca2+).
	GO:0004198	calcium-dependent cysteine-type endopeptidase activity	Catalysis of the hydrolysis of nonterminal peptide bonds in a polypeptide chain by a mechanism using a cysteine residue at the enzyme active center, and requiring the presence of calcium.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0046982	protein heterodimerization activity	Interacting selectively and non-covalently with a nonidentical protein to form a heterodimer.
biological process
	GO:0006508	proteolysis	The hydrolysis of proteins into smaller polypeptides and/or amino acids by cleavage of their peptide bonds.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1aj5)

	Sites
(no "Sites" information available for 1aj5)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1aj5)

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1aj5
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	CPNS1_RAT \| Q64537
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	CPNS1_RAT \| Q64537
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	CPNS1_RAT \| Q64537	:	1df0 1dvi 1np8 1u5i 3bow 3df0

(no "Related Entries Specified in the PDB File" available for 1AJ5)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (2, 10)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 2)

CATH Domains (1, 2)

Pfam Domains (0, 0)

Gene Ontology (9, 9)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File