|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
(no "Ligand,Modified Residues,Ions" information available for 1AFH) |
(no "Site" information available for 1AFH) |
NMR Structure
|
(no "Cis Peptide Bond" information available for 1AFH) |
(no "SAP(SNP)/Variant" information available for 1AFH) |
NMR Structure (1, 1)
|
(no "Exon" information available for 1AFH) |
NMR StructureChain A from PDB Type:PROTEIN Length:93 aligned with NLTP_MAIZE | P19656 from UniProtKB/Swiss-Prot Length:120 Alignment length:93 37 47 57 67 77 87 97 107 117 NLTP_MAIZE 28 AISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSRVN 120 SCOP domains d1afha_ A: Plant non-specific lipid-transfer protein (ns-LTP, ns-LTP1) SCOP domains CATH domains 1afhA00 A:1-93 Plant lipid-transfer and hydrophobic proteins CATH domains Pfam domains --------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------------------PLANT_LTP PDB: A:71-9- PROSITE Transcript --------------------------------------------------------------------------------------------- Transcript 1afh A 1 AISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSRVN 93 10 20 30 40 50 60 70 80 90
|
NMR Structure |
NMR Structure
|
(no "Pfam Domain" information available for 1AFH) |
NMR Structure(hide GO term definitions) Chain A (NLTP_MAIZE | P19656)
|
|
|
|
|
|
|