1ACA - JenaLib

NMR Structure - manually (Jmol Viewer)

NMR Structure - model 1 (Jmol Viewer)

NMR Structure - model 1, sites (Jmol Viewer)

NMR Structure - all models (Jmol Viewer)

Title :   THREE-DIMENSIONAL STRUCTURE OF THE COMPLEX BETWEEN ACYL-COENZYME A BINDING PROTEIN AND PALMITOYL-COENZYME A

Authors :   B. B. Kragelund, K. V. Andersen, J. C. Madsen, J. Knudsen, F. M. Poulsen

Date :   17 Nov 92 (Deposition) - 31 Jan 94 (Release) - 23 May 12 (Revision)

Method :   SOLUTION NMR

Resolution :   NOT APPLICABLE

Chains :   NMR Structure  : A  (20x)
NMR Structure *: A  (1x)

Keywords :   Acyl-Coenzyme A Binding Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   B. B. Kragelund, K. V. Andersen, J. C. Madsen, J. Knudsen, F. M. Poulsen
Three-Dimensional Structure Of The Complex Between Acyl-Coenzyme A Binding Protein And Palmitoyl-Coenzyme A.
J. Mol. Biol. V. 230 1260 1993
PubMed-ID: 8503960 | Reference-DOI: 10.1006/JMBI.1993.1240
(for further references see the PDB file header)

Molecule 1 - ACYL-COENZYME A BINDING PROTEIN
	Chains	:	A
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Taxid	:	562
	Organ	:	LIVER
	Organism Common	:	CATTLE
	Organism Scientific	:	BOS TAURUS
	Organism Taxid	:	9913

		1
NMR Structure (20x)	:	A
NMR Structure * (1x)	:	A

Summary Information (see also Sequences/Alignments below)

NMR Structure (2, 2)

No.	Name	Count	Type	Full Name
1	COA	1	Ligand/Ion	COENZYME A
2	PLM	1	Ligand/Ion	PALMITIC ACID

NMR Structure * (2, 2)

No.	Name	Count	Type	Full Name
1	COA	1	Ligand/Ion	COENZYME A
2	PLM	1	Ligand/Ion	PALMITIC ACID

NMR Structure (2, 2)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	ALA A:9 , VAL A:12 , LYS A:13 , LYS A:18 , MET A:24 , TYR A:28 , TYR A:31 , LYS A:32 , LYS A:50 , LYS A:54 , PLM A:88	BINDING SITE FOR RESIDUE COA A 87
2	AC2	SOFTWARE	VAL A:12 , LYS A:18 , PRO A:19 , ASP A:21 , MET A:24 , LEU A:25 , ILE A:27 , TYR A:28 , LYS A:50 , ALA A:53 , LYS A:54 , COA A:87	BINDING SITE FOR RESIDUE PLM A 88

(no "SS Bond" information available for 1ACA)

(no "Cis Peptide Bond" information available for 1ACA)

(no "SAP(SNP)/Variant" information available for 1ACA)

NMR Structure (2, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	ACB_2	PS51228	Acyl-CoA-binding (ACB) domain profile.	ACBP_BOVIN	2-87	1	A:1-86
2	ACB_1	PS00880	Acyl-CoA-binding (ACB) domain signature.	ACBP_BOVIN	20-38	1	A:19-37

NMR Structure * (2, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	ACB_2	PS51228	Acyl-CoA-binding (ACB) domain profile.	ACBP_BOVIN	2-87	1	A:1-86
2	ACB_1	PS00880	Acyl-CoA-binding (ACB) domain signature.	ACBP_BOVIN	20-38	1	A:19-37

NMR Structure (4, 4)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1	ENSBTAT00000012523	1	ENSBTAE00000400304	chr2:74658281-74658413	133	ACBP_BOVIN	1-3	3	1	A:1-2	2
1.2	ENSBTAT00000012523	2	ENSBTAE00000102049	chr2:74659451-74659568	118	ACBP_BOVIN	4-43	40	1	A:3-42	40
1.3	ENSBTAT00000012523	3	ENSBTAE00000102057	chr2:74661785-74661847	63	ACBP_BOVIN	43-64	22	1	A:42-63	22
1.4	ENSBTAT00000012523	4	ENSBTAE00000102063	chr2:74663168-74663461	294	ACBP_BOVIN	64-87	24	1	A:63-86	24

NMR Structure

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:86
 aligned with ACBP_BOVIN | P07107 from UniProtKB/Swiss-Prot  Length:87

    Alignment length:86
                                    11        21        31        41        51        61        71        81      
            ACBP_BOVIN    2 SQAEFDKAAEEVKHLKTKPADEEMLFIYSHYKQATVGDINTERPGMLDFKGKAKWDAWNELKGTSKEDAMKAYIDKVEELKKKYGI 87
               SCOP domains d1acaa_ A: Acyl-CoA binding protein                                                    SCOP domains
               CATH domains 1acaA00 A:1-86  [code=1.20.80.10, no name defined]                                     CATH domains
               Pfam domains -------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhh....hhhhhhhhhhhhhhhhh..............hhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) ACB_2  PDB: A:1-86 UniProt: 2-87                                                       PROSITE (1)
                PROSITE (2) ------------------ACB_1  PDB: A:19-37------------------------------------------------- PROSITE (2)
           Transcript 1 (1) 1.Exon 1.2  PDB: A:3-42 UniProt: 4-43     --------------------Exon 1.4  PDB: A:63-86   Transcript 1 (1)
           Transcript 1 (2) -----------------------------------------Exon 1.3  PDB: A:42-63----------------------- Transcript 1 (2)
                  1aca A  1 SQAEFDKAAEEVKHLKTKPADEEMLFIYSHYKQATVGDINTERPGMLDFKGKAKWDAWNELKGTSKEDAMKAYIDKVEELKKKYGI 86
                                    10        20        30        40        50        60        70        80

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

NMR Structure

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: All alpha proteins (14657)

Fold: Acyl-CoA binding protein-like (48)

Superfamily: Acyl-CoA binding protein (15)

Family: Acyl-CoA binding protein (10)

Protein domain: Acyl-CoA binding protein (7)

Cow (Bos taurus) [TaxId: 9913] (6)

d1acaa_

NMR Structure

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Mainly Alpha (13335)

Architecture: Up-down Bundle (3216)

Topology: Acyl-CoA Binding Protein (47)

Homologous Superfamily: [code=1.20.80.10, no name defined] (37)

Cattle (Bos taurus) (4)

1acaA00

A:1-86

(no "Pfam Domain" information available for 1ACA)

NMR Structure(hide GO term definitions)

Chain A (ACBP_BOVIN | P07107)

molecular function
	GO:0000062	fatty-acyl-CoA binding	Interacting selectively and non-covalently with acyl-CoA, any derivative of coenzyme A in which the sulfhydryl group is in thiolester linkage with a fatty acyl group.
	GO:0008289	lipid binding	Interacting selectively and non-covalently with a lipid.
	GO:0036042	long-chain fatty acyl-CoA binding	Interacting selectively and non-covalently with a long-chain fatty acyl-CoA. A long-chain fatty acyl-CoA is any derivative of coenzyme A in which the sulfhydryl group is in a thioester linkage with a long-chain fatty-acyl group. Long-chain fatty-acyl-CoAs have chain lengths of C13 or more.
	GO:0046983	protein dimerization activity	The formation of a protein dimer, a macromolecular structure consists of two noncovalently associated identical or nonidentical subunits.
biological process
	GO:0036151	phosphatidylcholine acyl-chain remodeling	Remodeling the acyl chains of phosphatidylcholine, through sequential deacylation and re-acylation reactions, to generate phosphatidylcholine containing different types of fatty acid acyl chains.
	GO:0006810	transport	The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
cellular component
	GO:0005794	Golgi apparatus	A compound membranous cytoplasmic organelle of eukaryotic cells, consisting of flattened, ribosome-free vesicles arranged in a more or less regular stack. The Golgi apparatus differs from the endoplasmic reticulum in often having slightly thicker membranes, appearing in sections as a characteristic shallow semicircle so that the convex side (cis or entry face) abuts the endoplasmic reticulum, secretory vesicles emerging from the concave side (trans or exit face). In vertebrate cells there is usually one such organelle, while in invertebrates and plants, where they are known usually as dictyosomes, there may be several scattered in the cytoplasm. The Golgi apparatus processes proteins produced on the ribosomes of the rough endoplasmic reticulum; such processing includes modification of the core oligosaccharides of glycoproteins, and the sorting and packaging of proteins for transport to a variety of cellular locations. Three different regions of the Golgi are now recognized both in terms of structure and function: cis, in the vicinity of the cis face, trans, in the vicinity of the trans face, and medial, lying between the cis and trans regions.
	GO:0005783	endoplasmic reticulum	The irregular network of unit membranes, visible only by electron microscopy, that occurs in the cytoplasm of many eukaryotic cells. The membranes form a complex meshwork of tubular channels, which are often expanded into slitlike cavities called cisternae. The ER takes two forms, rough (or granular), with ribosomes adhering to the outer surface, and smooth (with no ribosomes attached).
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
	GO:0097038	perinuclear endoplasmic reticulum	The portion of endoplasmic reticulum, the intracellular network of tubules and cisternae, that occurs near the nucleus. The lumen of the perinuclear endoplasmic reticulum is contiguous with the nuclear envelope lumen (also called perinuclear space), the region between the inner and outer nuclear membranes.

NMR Structure
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		COA	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		PLM	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1aca)

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ NMR Structure - model 1 PNG format \| NMR Structure - model 1, sites PNG format \| NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1aca
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	ACBP_BOVIN \| P07107
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	ACBP_BOVIN \| P07107
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	ACBP_BOVIN \| P07107	:	1hb6 1hb8 1nti 1nvl 2abd

(no "Related Entries Specified in the PDB File" available for 1ACA)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (2, 2)

Sites (2, 2)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (2, 2)

Exons (4, 4)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 1)

CATH Domains (1, 1)

Pfam Domains (0, 0)

Gene Ontology (10, 10)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File