1A9N | PTR016 - JenaLib

Biol.Unit 1 - manually (Jmol Viewer)

Asymmetric Unit (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Title :   CRYSTAL STRUCTURE OF THE SPLICEOSOMAL U2B''-U2A' PROTEIN COMPLEX BOUND TO A FRAGMENT OF U2 SMALL NUCLEAR RNA

Authors :   S. R. Price, P. R. Evans, K. Nagai

Date :   08 Apr 98 (Deposition) - 23 Sep 98 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.38

Chains :   Asym. Unit : A,B,C,D,Q,R
Biol. Unit 1: A,B,Q  (1x)
Biol. Unit 2: C,D,R  (1x)

Keywords :   Complex (Nuclear Protein/Rna), Rna, Snrnp, Ribonucleoprotein, Rna Binding Protein/Rna Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   S. R. Price, P. R. Evans, K. Nagai
Crystal Structure Of The Spliceosomal U2B"-U2A' Protein Complex Bound To A Fragment Of U2 Small Nuclear Rna.
Nature V. 394 645 1998
PubMed-ID: 9716128 | Reference-DOI: 10.1038/29234
(for further references see the PDB file header)

*Molecule 1 - RNA (5'- R(CPCPUPGPGPUPAPUPUPGPCPAPGPUPAPCPCPUPCP CPAPGP GPU)-3')*
	Chains	:	Q, R
	Engineered	:	YES
	Fragment	:	U2 HAIRPIN IV
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606

Molecule 2 - U2A'
	Chains	:	A, C
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI BL21(DE3)
	Expression System Cellular Location	:	CYTOPLASM
	Expression System Plasmid	:	PET3
	Expression System Strain	:	BL21 (DE3)
	Expression System Taxid	:	469008
	Expression System Vector Type	:	PLASMID
	Fragment	:	N-TERMINAL DOMAIN, RESIDUES 1 - 176 OF U2 A', A COMPONENT OF U2 SNRNP
	Mutation	:	YES
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Other Details	:	CDNA CLONE
	Synonym	:	U2A'

Molecule 3 - SPLICEOSOMAL U2B''
	Chains	:	B, D
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI BL21(DE3)
	Expression System Cellular Location	:	CYTOPLASM
	Expression System Plasmid	:	PET3
	Expression System Strain	:	BL21 (DE3)
	Expression System Taxid	:	469008
	Expression System Vector Type	:	PLASMID
	Fragment	:	RESIDUES 4 - 99 OF U2 B'', A COMPONENT OF U2 SNRNP
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Other Details	:	CDNA CLONE
	Synonym	:	SPLICEOSOMAL U2B''

		1	2	3	4	5	6
Asymmetric Unit	:	A	B	C	D	Q	R
Biological Unit 1 (1x)	:	A	B			Q
Biological Unit 2 (1x)	:			C	D		R

Summary Information (see also Sequences/Alignments below)

(no "Ligand,Modified Residues,Ions" information available for 1A9N)

(no "Site" information available for 1A9N)

Asymmetric Unit

No.	Residues
1	A:77	-	C:77

(no "Cis Peptide Bond" information available for 1A9N)

Asymmetric Unit (1, 2)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_035487	K	19	Q	RU2B_HUMAN	Unclassified	---	B/D	K	22	Q

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 1 (1, 1)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_035487	K	19	Q	RU2B_HUMAN	Unclassified	---	B	K	22	Q

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 2 (1, 1)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_035487	K	19	Q	RU2B_HUMAN	Unclassified	---	D	K	22	Q

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Asymmetric Unit (2, 10)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	RRM	PS50102	Eukaryotic RNA Recognition Motif (RRM) profile.	RU2B_HUMAN	7-86 151-225	2	B:10-89 D:10-89 -
2	LRR	PS51450	Leucine-rich repeat profile.	RU2A_HUMAN	20-41 43-64 65-86 89-110	8	A:20-41 C:20-41 A:43-64 C:43-64 A:65-86 C:65-86 A:90-110 C:90-110

Biological Unit 1 (2, 5)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	RRM	PS50102	Eukaryotic RNA Recognition Motif (RRM) profile.	RU2B_HUMAN	7-86 151-225	1	B:10-89 - -
2	LRR	PS51450	Leucine-rich repeat profile.	RU2A_HUMAN	20-41 43-64 65-86 89-110	4	A:20-41 - A:43-64 - A:65-86 - A:90-110 -

Biological Unit 2 (2, 5)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	RRM	PS50102	Eukaryotic RNA Recognition Motif (RRM) profile.	RU2B_HUMAN	7-86 151-225	1	- D:10-89 -
2	LRR	PS51450	Leucine-rich repeat profile.	RU2A_HUMAN	20-41 43-64 65-86 89-110	4	- C:20-41 - C:43-64 - C:65-86 - C:90-110

Asymmetric Unit (9, 18)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1a	ENST00000254193	1a	ENSE00001517454	chr15:101835487-101835302	186	RU2A_HUMAN	1-28	28	2	A:2-28 C:2-28	27 27
1.2	ENST00000254193	2	ENSE00000943259	chr15:101833377-101833230	148	RU2A_HUMAN	28-77	50	2	A:28-77 C:28-77	50 50
1.3	ENST00000254193	3	ENSE00000943260	chr15:101832245-101832167	79	RU2A_HUMAN	77-103	27	2	A:77-103 C:77-103	27 27
1.4	ENST00000254193	4	ENSE00001286790	chr15:101827907-101827861	47	RU2A_HUMAN	104-119	16	2	A:104-119 C:104-119	16 16
1.5a	ENST00000254193	5a	ENSE00001286785	chr15:101827215-101827113	103	RU2A_HUMAN	119-153	35	2	A:119-153 C:119-153	35 35
1.5c	ENST00000254193	5c	ENSE00000943263	chr15:101826498-101826419	80	RU2A_HUMAN	154-180	27	2	A:154-163 C:154-175	10 22
1.5d	ENST00000254193	5d	ENSE00001346033	chr15:101826006-101825931	76	RU2A_HUMAN	180-205	26	0	-	-
1.6	ENST00000254193	6	ENSE00001620646	chr15:101825265-101825172	94	RU2A_HUMAN	206-237	32	0	-	-
1.7b	ENST00000254193	7b	ENSE00001618359	chr15:101821987-101821715	273	RU2A_HUMAN	237-255	19	0	-	-

2.1a	ENST00000377943	1a	ENSE00001475586	chr20:16710606-16710709	104	RU2B_HUMAN	-	0	0	-	-
2.2	ENST00000377943	2	ENSE00002147088	chr20:16712313-16712411	99	RU2B_HUMAN	1-22	22	2	B:6-25 D:6-25	20 20
2.3a	ENST00000377943	3a	ENSE00000859180	chr20:16712809-16712981	173	RU2B_HUMAN	22-79	58	2	B:25-82 D:25-82	58 58
2.4	ENST00000377943	4	ENSE00000859181	chr20:16717906-16718046	141	RU2B_HUMAN	80-126	47	2	B:83-99 D:83-98	17 16
2.5	ENST00000377943	5	ENSE00000859183	chr20:16719497-16719547	51	RU2B_HUMAN	127-143	17	0	-	-
2.6	ENST00000377943	6	ENSE00000859186	chr20:16720970-16721058	89	RU2B_HUMAN	144-173	30	0	-	-
2.7	ENST00000377943	7	ENSE00001475638	chr20:16721491-16722421	931	RU2B_HUMAN	173-225	53	0	-	-

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:162
 aligned with RU2A_HUMAN | P09661 from UniProtKB/Swiss-Prot  Length:255

    Alignment length:162
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161  
           RU2A_HUMAN     2 VKLTAELIEQAAQYTNAVRDRELDLRGYKIPVIENLGATLDQFDAIDFSDNEIRKLDGFPLLRRLKTLLVNNNRICRIGEGLDQALPCLTELILTNNSLVELGDLDPLASLKSLTYLSILRNPVTNKKHYRLYVIYKVPQVRVLDFQKVKLKERQEAEKMFK 163
               SCOP domains d1a9na_ A: Splicesomal U2A' protein                                                                                                                                SCOP domains
               CATH domains 1a9nA00 A:2-163 Ribonuclease Inhibitor                                                                                                                             CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ....hhhhhh..eee.....eeee...........hhhh.....eee...................eee............hhhh.....eee........hhhhhhhhh.....eee....hhhh...hhhhhhhh.............hhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (2) ------------------LRR  PDB: A:20-41     -LRR  PDB: A:43-64     LRR  PDB: A:65-86     ----------------------------------------------------------------------------- PROSITE (2)
                PROSITE (1) ---------------------------------------------------------------------------------------LRR  PDB: A:90-110    ----------------------------------------------------- PROSITE (1)
           Transcript 1 (1) Exon 1.1a  PDB: A:2-28     ------------------------------------------------Exon 1.3  PDB: A:77-103    Exon 1.4        ----------------------------------Exon 1.5c  Transcript 1 (1)
           Transcript 1 (2) --------------------------Exon 1.2  PDB: A:28-77 UniProt: 28-77             -----------------------------------------Exon 1.5a  PDB: A:119-153          ---------- Transcript 1 (2)
                 1a9n A   2 VKLTAELIEQAAQYTNAVRDRELDLRGYKIPVIENLGATLDQFDAIDFSDNEIRKLDGFPLLRRLKTLLVNNNRICRIGEGLDQALPDLTELILTNNSLVELGDLDPLASLKSLTYLCILRNPVTNKKHYRLYVIYKVPQVRVLDFQKVKLKERQEAEKMFK 163
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161

Chain B from PDB  Type:PROTEIN  Length:94
 aligned with RU2B_HUMAN | P08579 from UniProtKB/Swiss-Prot  Length:225

    Alignment length:94
                                    12        22        32        42        52        62        72        82        92    
           RU2B_HUMAN     3 IRPNHTIYINNMNDKIKKEELKRSLYALFSQFGHVVDIVALKTMKMRGQAFVIFKELGSSTNALRQLQGFPFYGKPMRIQYAKTDSDIISKMRG  96
               SCOP domains d1a9nb_ B: Splicing factor U2B''                                                               SCOP domains
               CATH domains 1a9nB00 B:6-99  [code=3.30.70.330, no name defined]                                            CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....eeeee.......hhhhhhhhhhhhhhh..eeeee..........eeeee..hhhhhhhhhh...........eeee.....hhhhhh.. Sec.struct. author
                 SAPs(SNPs) ----------------Q----------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----RRM  PDB: B:10-89 UniProt: 7-86                                                 ---------- PROSITE
           Transcript 2 (1) Exon 2.2  PDB: B:6-2---------------------------------------------------------Exon 2.4          Transcript 2 (1)
           Transcript 2 (2) -------------------Exon 2.3a  PDB: B:25-82 UniProt: 22-79                    ----------------- Transcript 2 (2)
                 1a9n B   6 IRPNHTIYINNMNDKIKKEELKRSLYALFSQFGHVVDIVALKTMKMRGQAFVIFKELGSSTNALRQLQGFPFYGKPMRIQYAKTDSDIISKMRG  99
                                    15        25        35        45        55        65        75        85        95

Chain C from PDB  Type:PROTEIN  Length:174
 aligned with RU2A_HUMAN | P09661 from UniProtKB/Swiss-Prot  Length:255

    Alignment length:174
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171    
           RU2A_HUMAN     2 VKLTAELIEQAAQYTNAVRDRELDLRGYKIPVIENLGATLDQFDAIDFSDNEIRKLDGFPLLRRLKTLLVNNNRICRIGEGLDQALPCLTELILTNNSLVELGDLDPLASLKSLTYLSILRNPVTNKKHYRLYVIYKVPQVRVLDFQKVKLKERQEAEKMFKGKRGAQLAKDIA 175
               SCOP domains d1a9nc_ C: Splicesomal U2A' protein                                                                                                                                            SCOP domains
               CATH domains 1a9nC00 C:2-175 Ribonuclease Inhibitor                                                                                                                                         CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ....hhhhhh..eee.....eeee...........hhhh.....eee...................eee............hhhh.....eee........hhhhhhhhh.....eee....hhhh...hhhhhhhh.............hhhhhhhhh....hhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (2) ------------------LRR  PDB: C:20-41     -LRR  PDB: C:43-64     LRR  PDB: C:65-86     ----------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (1) ---------------------------------------------------------------------------------------LRR  PDB: C:90-110    ----------------------------------------------------------------- PROSITE (1)
           Transcript 1 (1) Exon 1.1a  PDB: C:2-28     ------------------------------------------------Exon 1.3  PDB: C:77-103    Exon 1.4        ----------------------------------Exon 1.5c [INCOMPLETE] Transcript 1 (1)
           Transcript 1 (2) --------------------------Exon 1.2  PDB: C:28-77 UniProt: 28-77             -----------------------------------------Exon 1.5a  PDB: C:119-153          ---------------------- Transcript 1 (2)
                 1a9n C   2 VKLTAELIEQAAQYTNAVRDRELDLRGYKIPVIENLGATLDQFDAIDFSDNEIRKLDGFPLLRRLKTLLVNNNRICRIGEGLDQALPDLTELILTNNSLVELGDLDPLASLKSLTYLCILRNPVTNKKHYRLYVIYKVPQVRVLDFQKVKLKERQEAEKMFKGKRGAQLAKDIA 175
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171

Chain D from PDB  Type:PROTEIN  Length:93
 aligned with RU2B_HUMAN | P08579 from UniProtKB/Swiss-Prot  Length:225

    Alignment length:93
                                    12        22        32        42        52        62        72        82        92   
           RU2B_HUMAN     3 IRPNHTIYINNMNDKIKKEELKRSLYALFSQFGHVVDIVALKTMKMRGQAFVIFKELGSSTNALRQLQGFPFYGKPMRIQYAKTDSDIISKMR  95
               SCOP domains d1a9nd_ D: Splicing factor U2B''                                                              SCOP domains
               CATH domains 1a9nD00 D:6-98  [code=3.30.70.330, no name defined]                                           CATH domains
               Pfam domains --------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....eeeee.......hhhhhhhhhhhhhhh..eeeee..........eeeee..hhhhhhhhhh...........eeee.....hhhhh.. Sec.struct. author
                 SAPs(SNPs) ----------------Q---------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----RRM  PDB: D:10-89 UniProt: 7-86                                                 --------- PROSITE
           Transcript 2 (1) Exon 2.2  PDB: D:6-2---------------------------------------------------------Exon 2.4         Transcript 2 (1)
           Transcript 2 (2) -------------------Exon 2.3a  PDB: D:25-82 UniProt: 22-79                    ---------------- Transcript 2 (2)
                 1a9n D   6 IRPNHTIYINNMNDKIKKEELKRSLYALFSQFGHVVDIVALKTMKMRGQAFVIFKELGSSTNALRQLQGFPFYGKPMRIQYAKTDSDIISKMR  98
                                    15        25        35        45        55        65        75        85        95

Chain Q from PDB  Type:RNA  Length:24
                                                        
                 1a9n Q   0 CCUGGUAUUGCAGUACCUCCAGGU  23
                                     9        19

Chain R from PDB  Type:RNA  Length:24
                                                        
                 1a9n R   0 CCUGGUAUUGCAGUACCUCCAGGU  23
                                     9        19

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Alpha Beta (26913)

Architecture: 2-Layer Sandwich (8480)

Topology: Alpha-Beta Plaits (1688)

Homologous Superfamily: [code=3.30.70.330, no name defined] (307)

Human (Homo sapiens) (81)

1a	1a9nD00	D:6-98
1b	1a9nB00	B:6-99

Architecture: Alpha-Beta Horseshoe (92)

Topology: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) (73)

Homologous Superfamily: Ribonuclease Inhibitor (73)

Human (Homo sapiens) (26)

2a	1a9nC00	C:2-175
2b	1a9nA00	A:2-163

(no "Pfam Domain" information available for 1A9N)

Asymmetric Unit(hide GO term definitions)

Chain A,C (RU2A_HUMAN | P09661)

molecular function
	GO:0003723	RNA binding	Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
	GO:0030620	U2 snRNA binding	Interacting selectively and non-covalently with the U2 small nuclear RNA (U2 snRNA).
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
	GO:0008380	RNA splicing	The process of removing sections of the primary RNA transcript to remove sequences not present in the mature form of the RNA and joining the remaining sections to form the mature form of the RNA.
	GO:0006397	mRNA processing	Any process involved in the conversion of a primary mRNA transcript into one or more mature mRNA(s) prior to translation into polypeptide.
	GO:0000398	mRNA splicing, via spliceosome	The joining together of exons from one or more primary transcripts of messenger RNA (mRNA) and the excision of intron sequences, via a spliceosomal mechanism, so that mRNA consisting only of the joined exons is produced.
cellular component
	GO:0005686	U2 snRNP	A ribonucleoprotein complex that contains small nuclear RNA U2.
	GO:0071013	catalytic step 2 spliceosome	A spliceosomal complex that contains three snRNPs, including U5, bound to a splicing intermediate in which the first catalytic cleavage of the 5' splice site has occurred. The precise subunit composition differs significantly from that of the catalytic step 1, or activated, spliceosome, and includes many proteins in addition to those found in the associated snRNPs.
	GO:0030529	intracellular ribonucleoprotein complex	An intracellular macromolecular complex containing both protein and RNA molecules.
	GO:0005654	nucleoplasm	That part of the nuclear content other than the chromosomes or the nucleolus.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
	GO:0030532	small nuclear ribonucleoprotein complex	A complex composed of RNA of the small nuclear RNA (snRNA) class and protein, found in the nucleus of a eukaryotic cell. These are typically named after the snRNA(s) they contain, e.g. U1 snRNP or U4/U6 snRNP. Many, but not all, of these complexes are involved in splicing of nuclear mRNAs.
	GO:0005681	spliceosomal complex	Any of a series of ribonucleoprotein complexes that contain snRNA(s) and small nuclear ribonucleoproteins (snRNPs), and are formed sequentially during the spliceosomal splicing of one or more substrate RNAs, and which also contain the RNA substrate(s) from the initial target RNAs of splicing, the splicing intermediate RNA(s), to the final RNA products. During cis-splicing, the initial target RNA is a single, contiguous RNA transcript, whether mRNA, snoRNA, etc., and the released products are a spliced RNA and an excised intron, generally as a lariat structure. During trans-splicing, there are two initial substrate RNAs, the spliced leader RNA and a pre-mRNA.

Chain B,D (RU2B_HUMAN | P08579)

molecular function
	GO:0003723	RNA binding	Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
	GO:0003676	nucleic acid binding	Interacting selectively and non-covalently with any nucleic acid.
	GO:0000166	nucleotide binding	Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0035614	snRNA stem-loop binding	Interacting selectively and non-covalently with a stem-loop in a small nuclear RNA (snRNA). An RNA stem-loop is a secondary RNA structure consisting of a double-stranded RNA (dsRNA) stem and a terminal loop.
biological process
	GO:0008380	RNA splicing	The process of removing sections of the primary RNA transcript to remove sequences not present in the mature form of the RNA and joining the remaining sections to form the mature form of the RNA.
	GO:0006397	mRNA processing	Any process involved in the conversion of a primary mRNA transcript into one or more mature mRNA(s) prior to translation into polypeptide.
	GO:0000398	mRNA splicing, via spliceosome	The joining together of exons from one or more primary transcripts of messenger RNA (mRNA) and the excision of intron sequences, via a spliceosomal mechanism, so that mRNA consisting only of the joined exons is produced.
	GO:0002230	positive regulation of defense response to virus by host	Any host process that results in the promotion of antiviral immune response mechanisms, thereby limiting viral replication.
	GO:0098792	xenophagy	The macroautophagy process in which a region of cytoplasm containing an intracellular pathogen or some part of an intracellular pathogen (e.g. viral capsid) is enclosed in a double membrane bound autophagosome, which then fuses with the lysosome leading to degradation of the contents.
cellular component
	GO:0005686	U2 snRNP	A ribonucleoprotein complex that contains small nuclear RNA U2.
	GO:0071013	catalytic step 2 spliceosome	A spliceosomal complex that contains three snRNPs, including U5, bound to a splicing intermediate in which the first catalytic cleavage of the 5' splice site has occurred. The precise subunit composition differs significantly from that of the catalytic step 1, or activated, spliceosome, and includes many proteins in addition to those found in the associated snRNPs.
	GO:0030529	intracellular ribonucleoprotein complex	An intracellular macromolecular complex containing both protein and RNA molecules.
	GO:0005730	nucleolus	A small, dense body one or more of which are present in the nucleus of eukaryotic cells. It is rich in RNA and protein, is not bounded by a limiting membrane, and is not seen during mitosis. Its prime function is the transcription of the nucleolar DNA into 45S ribosomal-precursor RNA, the processing of this RNA into 5.8S, 18S, and 28S components of ribosomal RNA, and the association of these components with 5S RNA and proteins synthesized outside the nucleolus. This association results in the formation of ribonucleoprotein precursors; these pass into the cytoplasm and mature into the 40S and 60S subunits of the ribosome.
	GO:0005654	nucleoplasm	That part of the nuclear content other than the chromosomes or the nucleolus.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
	GO:0005681	spliceosomal complex	Any of a series of ribonucleoprotein complexes that contain snRNA(s) and small nuclear ribonucleoproteins (snRNPs), and are formed sequentially during the spliceosomal splicing of one or more substrate RNAs, and which also contain the RNA substrate(s) from the initial target RNAs of splicing, the splicing intermediate RNA(s), to the final RNA products. During cis-splicing, the initial target RNA is a single, contiguous RNA transcript, whether mRNA, snoRNA, etc., and the released products are a spliced RNA and an excised intron, generally as a lariat structure. During trans-splicing, there are two initial substrate RNAs, the spliced leader RNA and a pre-mRNA.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1a9n)

	Sites
(no "Sites" information available for 1a9n)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1a9n)

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)
Molmol
	protein, nucleic acid: cartoon; ligands: spacefill; active site: sticks [ mono GIF format \| stereo GIF format ] (automatic, in case of more than 1 NMR structures only model 1 is shown)

Access by PDB/NDB ID
	1a9n
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	RU2A_HUMAN \| P09661
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	RU2B_HUMAN \| P08579
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	RU2A_HUMAN \| P09661
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	RU2B_HUMAN \| P08579
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	RU2A_HUMAN \| P09661	:	5mqf
	RU2B_HUMAN \| P08579	:	5mqf

(no "Related Entries Specified in the PDB File" available for 1A9N)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (1, 1)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (1, 2)

PROSITE Motifs (2, 10)

Exons (9, 18)

Sequences/Alignments

Classification and Annotation

SCOP Domains (2, 4)

CATH Domains (2, 4)

Pfam Domains (0, 0)

Gene Ontology (19, 30)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File