Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Biol.Unit 1 - manually
(-)Asym.Unit - manually
(-)Asymmetric Unit
(-)Biological Unit 1
collapse expand < >
Image Biol.Unit 1 - manually
Biol.Unit 1 - manually  (Jmol Viewer)
Image Asym.Unit - manually
Asym.Unit - manually  (Jmol Viewer)
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)

(-) Description

Title :  STRUCTURE OF TOBACCO RINGSPOT VIRUS
 
Authors :  J. E. Johnson, V. Chandrasekar
Date :  23 Feb 98  (Deposition) - 15 Jul 98  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  3.50
Chains :  Asym. Unit :  A
Biol. Unit 1:  A  (60x)
Keywords :  Trsv, Nepovirus, Virus Structure, Virus Evolution, Picornavirus Superfamily, Virus Capsid Protein, Icosahedral Virus (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  V. Chandrasekar, J. E. Johnson
The Structure Of Tobacco Ringspot Virus: A Link In The Evolution Of Icosahedral Capsids In The Picornavirus Superfamily.
Structure V. 6 157 1998
PubMed-ID: 9519407  |  Reference-DOI: 10.1016/S0969-2126(98)00018-5
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - TOBACCO RINGSPOT VIRUS CAPSID PROTEIN
    Chains: A
    Organism Scientific: TOBACCO RINGSPOT VIRUS
    Organism Taxid: 12282
    Strain: XANTHI-NC
    Synonym: TRSV

 Structural Features

(-) Chains, Units

  1
Asymmetric Unit : A
Biological Unit 1 (60x): A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1A6C)

(-) Sites  (0, 0)

(no "Site" information available for 1A6C)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1A6C)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1A6C)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1A6C)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1A6C)

(-) Exons   (0, 0)

(no "Exon" information available for 1A6C)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:513
 aligned with CAPSD_TRSV | Q88894 from UniProtKB/Swiss-Prot  Length:515

    Alignment length:513
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332       342       352       362       372       382       392       402       412       422       432       442       452       462       472       482       492       502       512   
           CAPSD_TRSV     3 AVTVVPDPTCCGTLSFKVPKDAKKGKHLGTFDIRQAIMDYGGLHSQEWCAKGIVNPTFTVRMHAPRNAFAGLSIACTFDDYKRIDLPALGNECPPSEMFELPTKVFMLKDADVHEWQFNYGELTGHGLCNWANVATQPTLYFFVASTNQVTMAADWQCIVTMHVDMGPVIDRFELNPTMTWPIQLGDTFAIDRYYEAKEIKLDGSTSMLSISYNFGGPVKHSKKHAISYSRAVMSRNLGWSGTISGSVKSVSSLFCTASFVIFPWECEAPPTLRQVLWGPHQIMHGDGQFEIAIKTRLHSAATTEEGFGRLGILPLSGPIAPDAHVGSYEFIVHINTWRPDSQVHPPMFSSSELYNWFTLTNLKPDANTGVVNFDIPGYIHDFASKDATVTLASNPLSWLVAATGWHYGEVDLCISWSRSKQAQAQEGSVSITTNYRDWGAYWQGQARIYDLRRTEAEIPIFLGSYAGATPSGALGKQNYVRISIVNAKDIVALRVCLRPKSIKFWGRSATLF 515
               SCOP domains d1a6ca1 A:1-176 Nepovirus capsid protein                                                                                                                                        d1a6ca2 A:177-348 Nepovirus capsid protein                                                                                                                                  d1a6ca3 A:349-513 Nepovirus capsid protein                                                                                                                            SCOP domains
               CATH domains 1a6cA01 A:1-348  [code=2.60.120.20, no name defined]                                                                                                                                                                                                                                                                                                        1a6cA02 A:349-513  [code=2.60.120.20, no name defined]                                                                                                                CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .........eeeeeeeee........eeeeeehhhhhhh..hhhhhhhhhh.....eeeeeee.........eeeeeee.....hhhh.....hhhh...eeeee.........eeeee...................eeeeee...........eeeeeeee.............................eee..eee.......eee..............eeeehhhhhh.......eeeeeeeee........eeeeeee.......hhhhhh...eee...eeeeee................eeeeeeee...........eeeeeeeeeeee.................eeee...........................eeee...hhhhhhh...eeeeeeeeeee.............eeeeee.......eeeeee....eeeeeee..................eeee.............eeeeeeeeeeee...eeee Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1a6c A   1 AVTVVPDPTCCGTLSFKVPKDAKKGKHLGTFDIRQAIMDYGGLHSQEWCAKGIVNPTFTVRMHAPRNAFAGLSIACTFDDYKRIDLPALGNECPPSEMFELPTKVFMLKDADVHEWQFNYGELTGHGLCNWANVATQPTLYFFVASTNQVTMAADWQCIVTMHVDMGPVIDRFELNPTMTWPIQLGDTFAIDRYYEAKEIKLDGSTSMLSISYNFGGPVKHSKKHAISYSRAVMSRNLGWSGTISGSVKSVSSLFCTASFVIFPWECEAPPTLRQVLWGPHQIMHGDGQFEIAIKTRLHSAATTEEGFGRLGILPLSGPIAPDAHVGSYEFIVHINTWRPDSQVHPPMFSSSELYNWFTLTNLKPDANTGVVNFDIPGYIHDFASKDATVTLASNPLSWLVAATGWHYGEVDLCISWSRSKQAQAQEGSVSITTNYRDWGAYWQGQARIYDLRRTEAEIPIFLGSYAGATPSGALGKQNYVRISIVNAKDIVALRVCLRPKSIKFWGRSATLF 513
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410       420       430       440       450       460       470       480       490       500       510
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 3)

Asymmetric Unit
(-)
Class: All beta proteins (24004)

(-) CATH Domains  (1, 2)

Asymmetric Unit
(-)
Class: Mainly Beta (13760)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1A6C)

(-) Gene Ontology  (3, 3)

Asymmetric Unit(hide GO term definitions)
Chain A   (CAPSD_TRSV | Q88894)
molecular function
    GO:0005198    structural molecule activity    The action of a molecule that contributes to the structural integrity of a complex or its assembly within or outside a cell.
cellular component
    GO:0019028    viral capsid    The protein coat that surrounds the infective nucleic acid in some virus particles. It comprises numerous regularly arranged subunits, or capsomeres.
    GO:0019012    virion    The complete fully infectious extracellular virus particle.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1a6c)
 
  Sites
(no "Sites" information available for 1a6c)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1a6c)
 
Biological Unit
  Complete Structure
    Biological Unit 1  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Biol. Unit 1 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1a6c
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  CAPSD_TRSV | Q88894
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  CAPSD_TRSV | Q88894
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1A6C)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1A6C)