Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - manually
(-)NMR Structure - model 1
(-)NMR Structure - model 1, sites
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - manually
NMR Structure - manually  (Jmol Viewer)
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - model 1, sites
NMR Structure - model 1, sites  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  SOLUTION STRUCTURE OF DESULFOVIBRIO VULGARIS (HILDENBOROUGH) FERROCYTOCHROME C3, NMR, 20 STRUCTURES
 
Authors :  A. C. Messias, D. H. K. Kastrau, H. S. Costa, J. Legall, D. L. Turner, H. Santos, A. V. Xavier
Date :  05 Jan 98  (Deposition) - 08 Jul 98  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (20x)
Keywords :  Electron Transport, Hemeprotein, Electron Transfer, Redox- Bohr Effect, Cooperativity, Energy Transduction (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  A. C. Messias, D. H. Kastrau, H. S. Costa, J. Legall, D. L. Turner, H. Santos, A. V. Xavier
Solution Structure Of Desulfovibrio Vulgaris (Hildenborough) Ferrocytochrome C3: Structural Basis For Functional Cooperativity.
J. Mol. Biol. V. 281 719 1998
PubMed-ID: 9710542  |  Reference-DOI: 10.1006/JMBI.1998.1974
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - CYTOCHROME C3
    Cellular LocationPERIPLASM
    ChainsA
    Organism ScientificDESULFOVIBRIO VULGARIS SUBSP. VULGARIS STR. HILDENBOROUGH
    Organism Taxid882
    Other DetailsCLASS III OF C-TYPE CYTOCHROMES, FULLY REDUCED FORM
    StrainHILDENBOROUGH
    SynonymTETRAHEME CYTOCHROME

 Structural Features

(-) Chains, Units

  
NMR Structure (20x)

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 4)

NMR Structure (1, 4)
No.NameCountTypeFull Name
1HEC4Ligand/IonHEME C

(-) Sites  (4, 4)

NMR Structure (4, 4)
No.NameEvidenceResiduesDescription
1AC1SOFTWARELYS A:3 , ALA A:4 , PRO A:5 , LEU A:9 , MET A:11 , PHE A:20 , HIS A:22 , HIS A:25 , VAL A:28 , LYS A:29 , CYS A:30 , CYS A:33 , HIS A:34 , TYR A:43 , ARG A:44 , LYS A:45 , CYS A:46 , HEC A:109 , HEC A:110BINDING SITE FOR RESIDUE HEC A 108
2AC2SOFTWARECYS A:33 , HIS A:35 , LYS A:45 , CYS A:46 , CYS A:51 , HIS A:52 , SER A:61 , ALA A:62 , HIS A:67 , VAL A:68 , ASN A:73 , THR A:74 , LYS A:75 , PHE A:76 , HEC A:108BINDING SITE FOR RESIDUE HEC A 109
3AC3SOFTWAREPHE A:20 , THR A:24 , HIS A:25 , ASP A:32 , CYS A:33 , LYS A:77 , CYS A:79 , CYS A:82 , HIS A:83 , VAL A:86 , LEU A:97 , LYS A:104 , HEC A:108BINDING SITE FOR RESIDUE HEC A 110
4AC4SOFTWAREMET A:11 , ALA A:13 , THR A:14 , GLN A:16 , VAL A:18 , TYR A:65 , TYR A:66 , HIS A:70 , VAL A:80 , HIS A:83 , LEU A:97 , THR A:98 , GLY A:99 , CYS A:100 , CYS A:105 , HIS A:106BINDING SITE FOR RESIDUE HEC A 111

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1A2I)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1A2I)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1A2I)

(-) PROSITE Motifs  (1, 1)

NMR Structure (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1MULTIHEME_CYTCPS51008 Multiheme cytochrome c family profile.CYC3_DESVH47-110  1A:25-88

(-) Exons   (0, 0)

(no "Exon" information available for 1A2I)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:107
 aligned with CYC3_DESVH | P00131 from UniProtKB/Swiss-Prot  Length:129

    Alignment length:107
                                    32        42        52        62        72        82        92       102       112       122       
           CYC3_DESVH    23 APKAPADGLKMEATKQPVVFNHSTHKSVKCGDCHHPVNGKEDYRKCGTAGCHDSMDKKDKSAKGYYHVMHDKNTKFKSCVGCHVEVAGADAAKKKDLTGCKKSKCHE 129
               SCOP domains d1a2ia_ A: Cytochrome c3                                                                                    SCOP domains
               CATH domains 1a2iA00 A:1-107 Cytochrome C3                                                                               CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........eee......eee........hhhhhh.............................hhhhh.........hhhhhhhhhhh...hhh............. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------MULTIHEME_CYTC  PDB: A:25-88 UniProt: 47-110                    ------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------- Transcript
                 1a2i A   1 APKAPADGLKMEATKQPVVFNHSTHKSVKCGDCHHPVNGKEDYRKCGTAGCHDSMDKKDKSAKGYYHVMHDKNTKFKSCVGCHVEVAGADAAKKKDLTGCKKSKCHE 107
                                    10        20        30        40        50        60        70        80        90       100       

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

NMR Structure

(-) CATH Domains  (1, 1)

NMR Structure
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1A2I)

(-) Gene Ontology  (6, 6)

NMR Structure(hide GO term definitions)
Chain A   (CYC3_DESVH | P00131)
molecular function
    GO:0009055    electron carrier activity    Any molecular entity that serves as an electron acceptor and electron donor in an electron transport chain. An electron transport chain is a process in which a series of electron carriers operate together to transfer electrons from donors to any of several different terminal electron acceptors to generate a transmembrane electrochemical gradient.
    GO:0020037    heme binding    Interacting selectively and non-covalently with heme, any compound of iron complexed in a porphyrin (tetrapyrrole) ring.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
biological process
    GO:0009061    anaerobic respiration    The enzymatic release of energy from inorganic and organic compounds (especially carbohydrates and fats) which uses compounds other than oxygen (e.g. nitrate, sulfate) as the terminal electron acceptor.
    GO:0055114    oxidation-reduction process    A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
cellular component
    GO:0042597    periplasmic space    The region between the inner (cytoplasmic) and outer membrane (Gram-negative Bacteria) or cytoplasmic membrane and cell wall (Fungi and Gram-positive Bacteria).

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    HEC  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1a2i)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1a2i
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  CYC3_DESVH | P00131
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  CYC3_DESVH | P00131
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        CYC3_DESVH | P001311gx7 1mdv 2bpn 2cth 2cym

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1A2I)