Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit - manually
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit - manually
Asym./Biol. Unit - manually  (Jmol Viewer)
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  HYPOTHETICAL PROTEIN FROM PLASMODIUM FALCIPARUM
 
Authors :  M. A. Holmes, E. A. Merritt, Structural Genomics Of Pathogenic Pro Consortium (Sgpp)
Date :  24 May 05  (Deposition) - 07 Jun 05  (Release) - 24 Oct 12  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.17
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Structural Genomics, Psi, Protein Structure Initiative, Structural Genomics Of Pathogenic Protozoa Consortium, Sgpp, Unknown Function (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  M. A. Holmes, F. S. Buckner, W. C. Van Voorhis, C. Mehlin, E. Boni, T. N. Earnest, G. Detitta, J. Luft, A. Lauricella, L. Anderson, O. Kalyuzhniy, F. Zucker, L. W. Schoenfeld, W. G. Hol, E. A. Merritt
Structure Of The Conserved Hypothetical Protein Mal13P1. 257 From Plasmodium Falciparum.
Acta Crystallogr. , Sect. F V. 62 180 2006
PubMed-ID: 16511296  |  Reference-DOI: 10.1107/S1744309106005847

(-) Compounds

Molecule 1 - HYPOTHETICAL PROTEIN
    Chains: A, B
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PET3A
    Expression System Taxid: 562
    Expression System Vector Type: PLASMID
    Gene: MAL13P1.257
    Organism Common: MALARIA PARASITE P. FALCIPARUM
    Organism Scientific: PLASMODIUM FALCIPARUM
    Organism Taxid: 5833

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit : AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 6)

Asymmetric/Biological Unit (1, 6)
No.NameCountTypeFull Name
1MSE6Mod. Amino AcidSELENOMETHIONINE

(-) Sites  (0, 0)

(no "Site" information available for 1ZSO)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1ZSO)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1ZSO)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1ZSO)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1ZSO)

(-) Exons   (0, 0)

(no "Exon" information available for 1ZSO)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:156
 aligned with Q8IDI8_PLAF7 | Q8IDI8 from UniProtKB/TrEMBL  Length:156

    Alignment length:156
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150      
         Q8IDI8_PLAF7     1 MKNTVVRIKAELENVKRLFCDDEYLWIFNIRDSTSSLTRDNIQFRKTDILEIPNSRGTANFMIKWTEYPKYSTINFVNTKNSCSYEEVNNNEWRDFASFECRGIELIDFFPSNNFIVEDTKGKLYYDVNLSDQNWCDYNEEHEMCVGIYNLEYEVN 156
               SCOP domains d1zsoa1 A:1-156 Hypothetical protein MAL13P1.257                                                                                                             SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ...eeeeeeeeee.eeeee......eeeeeee.....eeeeeee.....ee......ee.eee........eeeeee......eee.hhh...eeeeeeeee.eeeeee.....eeeee....eeeee......eeeee....eeeeeeeeeeeee Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 1zso A   1 mKNTVVRIKAELENVKRLFCDDEYLWIFNIRDSTSSLTRDNIQFRKTDILEIPNSRGTANFmIKWTEYPKYSTINFVNTKNSCSYEEVNNNEWRDFASFECRGIELIDFFPSNNFIVEDTKGKLYYDVNLSDQNWCDYNEEHEmCVGIYNLEYEVN 156
                            |       10        20        30        40        50        60 |      70        80        90       100       110       120       130       140   |   150      
                            |                                                           62-MSE                                                                           144-MSE        
                            1-MSE                                                                                                                                                       


Chain B from PDB  Type:PROTEIN  Length:159
 aligned with Q8IDI8_PLAF7 | Q8IDI8 from UniProtKB/TrEMBL  Length:156

    Alignment length:159
                               1                                                                                                                                                           
                               |     7        17        27        37        47        57        67        77        87        97       107       117       127       137       147         
         Q8IDI8_PLAF7     - ---MKNTVVRIKAELENVKRLFCDDEYLWIFNIRDSTSSLTRDNIQFRKTDILEIPNSRGTANFMIKWTEYPKYSTINFVNTKNSCSYEEVNNNEWRDFASFECRGIELIDFFPSNNFIVEDTKGKLYYDVNLSDQNWCDYNEEHEMCVGIYNLEYEVN 156
               SCOP domains d1zsob_ B: Hypothetical protein MAL13P1.257                                                                                                                     SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
           Pfam domains (1) ---DUF866-1zsoB01 B:1-156                                                                                                                                       Pfam domains (1)
           Pfam domains (2) ---DUF866-1zsoB02 B:1-156                                                                                                                                       Pfam domains (2)
         Sec.struct. author ...eeeeeeeeeeeee.eeeee......eeeeeee.....eeeeeee.....ee......ee.eee........eeeeee......eee.hhh...eeeeeeeee.eeeeee.....eeeee....eeeee......eeeee....eeeeeeeeeeeee Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1zso B  -3 HHHmKNTVVRIKAELENVKRLFCDDEYLWIFNIRDSTSSLTRDNIQFRKTDILEIPNSRGTANFmIKWTEYPKYSTINFVNTKNSCSYEEVNNNEWRDFASFECRGIELIDFFPSNNFIVEDTKGKLYYDVNLSDQNWCDYNEEHEmCVGIYNLEYEVN 156
                              ||     7        17        27        37        47        57    |   67        77        87        97       107       117       127       137      |147         
                             -1|                                                           62-MSE                                                                           144-MSE        
                               1-MSE
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Class: All beta proteins (24004)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 1ZSO)

(-) Pfam Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Clan: no clan defined [family: DUF866] (1)

(-) Gene Ontology  (0, 0)

Asymmetric/Biological Unit(hide GO term definitions)
    (no "Gene Ontology" information available for 1ZSO)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    MSE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
(no "Sites" information available for 1zso)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1zso)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1zso
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q8IDI8_PLAF7 | Q8IDI8
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q8IDI8_PLAF7 | Q8IDI8
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1ZSO)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1ZSO)