1ZOY - JenaLib

Asym./Biol. Unit (Jmol Viewer)

Asym./Biol. Unit - sites (Jmol Viewer)

Title :   CRYSTAL STRUCTURE OF MITOCHONDRIAL RESPIRATORY COMPLEX II FROM PORCINE HEART AT 2.4 ANGSTROMS

Authors :   F. Sun, X. Huo, Y. Zhai, A. Wang, J. Xu, D. Su, M. Bartlam, Z. Rao

Date :   15 May 05 (Deposition) - 12 Jul 05 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.40

Chains :   Asym./Biol. Unit : A,B,C,D

Keywords :   Succinate, Ubiquinone Oxidoreductase, Mitochondrial Respiratory Complex Ii, Membrane Protein Structure (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   F. Sun, X. Huo, Y. Zhai, A. Wang, J. Xu, D. Su, M. Bartlam, Z. Rao
Crystal Structure Of Mitochondrial Respiratory Membrane Protein Complex Ii
Cell(Cambridge, Mass. ) V. 121 1043 2005
PubMed-ID: 15989954 | Reference-DOI: 10.1016/J.CELL.2005.05.025
(for further references see the PDB file header)

Molecule 1 - FAD-BINDING PROTEIN
	Chains	:	A
	EC Number	:	1.3.5.1
	Organism Common	:	PIG
	Organism Scientific	:	SUS SCROFA
	Organism Taxid	:	9823
	Synonym	:	FLAVOPROTEIN
	Tissue	:	PORCINE HEART

Molecule 2 - IRON-SULFUR PROTEIN
	Chains	:	B
	EC Number	:	1.3.5.1
	Organism Common	:	PIG
	Organism Scientific	:	SUS SCROFA
	Organism Taxid	:	9823
	Tissue	:	PORCINE HEART

Molecule 3 - LARGE CYTOCHROME BINDING PROTEIN
	Chains	:	C
	Organism Common	:	PIG
	Organism Scientific	:	SUS SCROFA
	Organism Taxid	:	9823
	Tissue	:	PORCINE HEART

Molecule 4 - SMALL CYTOCHROME BINDING PROTEIN
	Chains	:	D
	Organism Common	:	PIG
	Organism Scientific	:	SUS SCROFA
	Organism Taxid	:	9823
	Tissue	:	PORCINE HEART

		1	2	3	4
Asymmetric/Biological Unit	:	A	B	C	D

Summary Information (see also Sequences/Alignments below)

Asymmetric/Biological Unit (7, 8)

No.	Name	Count	Type	Full Name
1	EPH	2	Ligand/Ion	L-ALPHA-PHOSPHATIDYL-BETA-OLEOYL-GAMMA-PALMITOYL-PHOSPHATIDYLETHANOLAMINE
2	F3S	1	Ligand/Ion	FE3-S4 CLUSTER
3	FAD	1	Ligand/Ion	FLAVIN-ADENINE DINUCLEOTIDE
4	FES	1	Ligand/Ion	FE2/S2 (INORGANIC) CLUSTER
5	HEM	1	Ligand/Ion	PROTOPORPHYRIN IX CONTAINING FE
6	SF4	1	Ligand/Ion	IRON/SULFUR CLUSTER
7	UQ1	1	Ligand/Ion	UBIQUINONE-1

Asymmetric Unit (8, 8)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	GLY A:26 , ALA A:27 , GLY A:28 , GLY A:29 , ALA A:30 , VAL A:48 , THR A:49 , LYS A:50 , LEU A:51 , SER A:56 , HIS A:57 , THR A:58 , ALA A:60 , ALA A:61 , GLN A:62 , GLY A:63 , GLY A:64 , TYR A:177 , PHE A:178 , ALA A:179 , ALA A:213 , THR A:214 , GLY A:215 , THR A:225 , ASP A:233 , LEU A:264 , HIS A:365 , TYR A:366 , GLY A:397 , GLU A:398 , ARG A:409 , ALA A:412 , ASN A:413 , SER A:414 , LEU A:415 , LEU A:418 , HOH A:703 , HOH A:705 , HOH A:769 , HOH A:790 , HOH A:796 , HOH A:847 , HOH A:886	BINDING SITE FOR RESIDUE FAD A 700
2	AC2	SOFTWARE	SER B:64 , CYS B:65 , ARG B:66 , GLY B:68 , CYS B:70 , GLY B:71 , CYS B:73 , CYS B:85	BINDING SITE FOR RESIDUE FES B 302
3	AC3	SOFTWARE	CYS B:158 , CYS B:161 , ALA B:162 , CYS B:164 , CYS B:225 , PRO B:226	BINDING SITE FOR RESIDUE SF4 B 303
4	AC4	SOFTWARE	CYS B:168 , TYR B:178 , PRO B:181 , CYS B:215 , HIS B:216 , MET B:219 , ASN B:220 , CYS B:221 , HOH B:1260	BINDING SITE FOR RESIDUE F3S B 304
5	AC5	SOFTWARE	HOH B:1211 , HOH B:1249 , ARG C:46 , GLY C:49 , LEU C:52 , SER C:53 , HIS C:101 , THR C:102 , GLY C:105 , HIS C:108 , LEU D:53 , LEU D:57 , HIS D:79 , GLY D:83 , VAL D:87 , HOH D:1309	BINDING SITE FOR RESIDUE HEM C 1305
6	AC6	SOFTWARE	ALA D:60 , TYR D:61 , PRO D:64 , LEU D:72 , TRP D:134 , HOH D:1326	BINDING SITE FOR RESIDUE EPH D 1306
7	AC7	SOFTWARE	LEU C:135 , GLY C:139 , ALA C:142 , MET C:143 , LYS D:99 , ALA D:103 , HOH D:1324	BINDING SITE FOR RESIDUE EPH D 1307
8	AC8	SOFTWARE	TRP B:173 , ILE B:218 , HOH B:1272 , TRP C:35 , ILE C:43 , TYR D:91	BINDING SITE FOR RESIDUE UQ1 B 1201

(no "SS Bond" information available for 1ZOY)

(no "Cis Peptide Bond" information available for 1ZOY)

(no "SAP(SNP)/Variant" information available for 1ZOY)

Asymmetric/Biological Unit (7, 7)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	2FE2S_FER_2	PS51085	2Fe-2S ferredoxin-type iron-sulfur binding domain profile.	SDHB_PIG	40-131	1	B:12-103
2	SDH_CYT_1	PS01000	Succinate dehydrogenase cytochrome b subunit signature 1.	C560_PIG	50-74	1	C:24-48
3	2FE2S_FER_1	PS00197	2Fe-2S ferredoxin-type iron-sulfur binding region signature.	SDHB_PIG	93-101	1	B:65-73
4	FRD_SDH_FAD_BINDING	PS00504	Fumarate reductase / succinate dehydrogenase FAD-binding site.	SDHA_PIG	97-106	1	A:55-64
5	SDH_CYT_2	PS01001	Succinate dehydrogenase cytochrome b subunit signature 2.	C560_PIG	127-140	1	C:101-114
6	4FE4S_FER_2	PS51379	4Fe-4S ferredoxin-type iron-sulfur binding domain profile.	SDHB_PIG	176-206	1	B:148-178
7	4FE4S_FER_1	PS00198	4Fe-4S ferredoxin-type iron-sulfur binding region signature.	SDHB_PIG	186-197	1	B:158-169

(no "Exon" information available for 1ZOY)

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:613
 aligned with SDHA_PIG | Q0QF01 from UniProtKB/Swiss-Prot  Length:664

    Alignment length:613
                                    61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       441       451       461       471       481       491       501       511       521       531       541       551       561       571       581       591       601       611       621       631       641       651       661   
             SDHA_PIG    52 STQYPVVDHEFDAVVVGAGGAGLRAAFGLSEAGFNTACVTKLFPTRSHTVAAQGGINAALGNMEEDNWRWHFYDTVKGSDWLGDQDAIHYMTEQAPASVVELENYGMPFSRTEDGKIYQRAFGGQSLKFGKGGQAHRCCCVADRTGHSLLHTLYGRSLRYDTSYFVEYFALDLLMENGECRGVIALCIEDGSIHRIRARNTVVATGGYGRTYFSCTSAHTSTGDGTAMVTRAGLPCQDLEFVQFHPTGIYGAGCLITEGCRGEGGILINSQGERFMERYAPVAKDLASRDVVSRSMTLEIREGRGCGPEKDHVYLQLHHLPPEQLAVRLPGISETAMIFAGVDVTKEPIPVLPTVHYNMGGIPTNYKGQVLRHVNGQDQVVPGLYACGEAACASVHGANRLGANSLLDLVVFGRACALSIAESCRPGDKVPSIKPNAGEESVMNLDKLRFANGTIRTSELRLSMQKSMQSHAAVFRVGSVLQEGCEKILRLYGDLQHLKTFDRGMVWNTDLVETLELQNLMLCALQTIYGAEARKESRGAHAREDFKERVDEYDYSKPIQGQQKKPFQEHWRKHTLSYVDVKTGKVSLEYRPVIDKTLNEADCATVPPAIRSY 664
               SCOP domains d1zoya1 A:10-273,A:361-445 Succinate dehydogenase                                                                                                                                                                                                                       d1zoya2 A:274-360 Succinate dehydogenase                                               d1zoya1 A:10-273,A:361-445 Succinate dehydogenase                                    d1zoya3 A:446-622 Succinate dehydogenase                                                                                                                                          SCOP domains
               CATH domains 1zoyA01 A:10-257,A:362-440  [code=3.50.50.60, no name defined]                                                                                                                                                                                          1zoyA02 A:258-361 Flavocytochrome C3; Chain A, domain 1                                                 1zoyA01 A:10-257,A:362-440  [code=3.50.50.60, no name defined]                 1zoyA03 A:441-557  [code=1.20.58.100, no name defined]                                                               1zoyA04 A:558-622 succinate dehydrogenase protein domain          CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....eeeee..eeee..hhhhhhhhhhhhhh...eeeee..hhhhhhhhhh...ee.........hhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhh............eeeeeeee.......eeeeee....hhhhhhhhhhhhhhh....eeee.eeeeeeeee..eeeeeeeee.....eeeee..eeee....hhhhh..........hhhhhhhhhh...ee....eeee............hhhhhhh.eee...................hhhhhhhhhhhhhhhh..........eee......hhhhhhhhhhhhhhhhhhh............eeeee...ee.....eeeeee..eeeeeeeeee....ee...........hhhhhhhhhhhhhhhhhhhhh.............hhhhhhhhhhhhh....eehhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhh..ee........hhhhhhhhhhhhhhhhhhhhhhhhhhh...............................hhhhh...eeeeee......eeeeee...................... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ---------------------------------------------FRD_SDH_FA------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE (3)
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1zoy A  10 STQYPVVDHEFDAVVVGAGGAGLRAAFGLSEAGFNTACVTKLFPTRSHTVAAQGGINAALGNMEEDNWRWHFYDTVKGSDWLGDQDAIHYMTEQAPASVVELENYGMPFSRTEDGKIYQRAFGGQSLKFGKGGQAHRCCCVADRTGHSLLHTLYGRSLRYDTSYFVEYFALDLLMENGECRGVIALCIEDGSIHRIRARNTVVATGGYGRTYFSCTSAHTSTGDGTAMVTRAGLPCQDLEFVQFHPTGIYGAGCLITEGCRGEGGILINSQGERFMERYAPVAKDLASRDVVSRSMTLEIREGRGCGPEKDHVYLQLHHLPPEQLAVRLPGISETAMIFAGVDVTKEPIPVLPTVHYNMGGIPTNYKGQVLRHVNGQDQVVPGLYACGEAACASVHGANRLGANSLLDLVVFGRACALSIAESCRPGDKVPSIKPNAGEESVMNLDKLRFANGTIRTSELRLSMQKSMQSHAAVFRVGSVLQEGCEKILRLYGDLQHLKTFDRGMVWNTDLVETLELQNLMLCALQTIYGAEARKESRGAHAREDFKERVDEYDYSKPIQGQQKKPFQEHWRKHTLSYVDVKTGKVSLEYRPVIDKTLNEADCATVPPAIRSY 622
                                    19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299       309       319       329       339       349       359       369       379       389       399       409       419       429       439       449       459       469       479       489       499       509       519       529       539       549       559       569       579       589       599       609       619

Chain B from PDB  Type:PROTEIN  Length:239
 aligned with SDHB_PIG | Q007T0 from UniProtKB/Swiss-Prot  Length:280

    Alignment length:239
                                    46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266         
             SDHB_PIG    37 PRIKKFAIYRWDPDKTGDKPHMQTYEIDLNNCGPMVLDALIKIKNEIDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTNLDKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEEREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTGTCPKGLNPGKAIAEIKKMMATYKE 275
               SCOP domains d1zoyb1 B:9-114 Succinate dehydogenase iron-sulfur protein, N-terminal domain                             d1zoyb2 B:115-247 Succinate dehydogenase                                                                                              SCOP domains
               CATH domains 1zoyB01 B:9-114  [code=3.10.20.30, no name defined]                                                       1zoyB02 B:115-247 Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2                                                           CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeeeee..........eeeeeeee.hhh..hhhhhhhhhhhh....................eee..eee.............eeeee......eee..ee.hhhhhhhhhhh...................hhhhhhh............hhhhhhhhhhhh...hhhhhhhhhhhhhh.....hhhhhhhh...............hhhhh....hhhhhhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) ---2FE2S_FER_2  PDB: B:12-103 UniProt: 40-131                                                  --------------------------------------------4FE4S_FER_2  PDB: B:148-178    --------------------------------------------------------------------- PROSITE (1)
                PROSITE (2) --------------------------------------------------------2FE2S_FER------------------------------------------------------------------------------------4FE4S_FER_1 ------------------------------------------------------------------------------ PROSITE (2)
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1zoy B   9 PRIKKFAIYRWDPDKTGDKPHMQTYEIDLNNCGPMVLDALIKIKNEIDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTNLDKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEEREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTGTCPKGLNPGKAIAEIKKMMATYKE 247
                                    18        28        38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238

Chain C from PDB  Type:PROTEIN  Length:138
 aligned with C560_PIG | D0VWV4 from UniProtKB/Swiss-Prot  Length:169

    Alignment length:138
                                    41        51        61        71        81        91       101       111       121       131       141       151       161        
             C560_PIG    32 TTAKEEMERFWNKNLGSNRPLSPHITIYRWSLPMAMSICHRGTGIALSAGVSLFGLSALLLPGNFESHLELVKSLCLGPTLIYTAKFGIVFPLMYHTWNGIRHLIWDLGKGLTIPQLTQSGVVVLILTVLSSVGLAAM 169
               SCOP domains d1zoyc_ C: Large cytochrome binding protein CybL                                                                                           SCOP domains
               CATH domains 1zoyC01 C:6-35                1zoyC02 C:36-143 Fumarate reductase respiratory complex transmembrane subunits                               CATH domains
               Pfam domains ---------------Sdh_cyt-1zoyC01 C:21-140                                                                                                --- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhh..............hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (2) ------------------SDH_CYT_1  PDB: C:24-48  ----------------------------------------------------SDH_CYT_2     ----------------------------- PROSITE (2)
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 1zoy C   6 TTAKEEMERFWNKNLGSNRPLSPHITIYRWSLPMAMSICHRGTGIALSAGVSLFGLSALLLPGNFESHLELVKSLCLGPTLIYTAKFGIVFPLMYHTWNGIRHLIWDLGKGLTIPQLTQSGVVVLILTVLSSVGLAAM 143
                                    15        25        35        45        55        65        75        85        95       105       115       125       135

Chain D from PDB  Type:PROTEIN  Length:102
 aligned with DHSD_PIG | A5GZW8 from UniProtKB/Swiss-Prot  Length:159

    Alignment length:102
                                    67        77        87        97       107       117       127       137       147       157  
             DHSD_PIG    58 SSKAASLHWTGERVVSVLLLGLLPAAYLNPCSAMDYSLAAALTLHGHWGIGQVVTDYVRGDALQKVAKAGLLALSAFTFAGLCYFNYHDVGICKAVAMLWKL 159
               SCOP domains d1zoyd_ D: Small cytochrome binding protein CybS                                                       SCOP domains
               CATH domains 1zoyD00 D:35-136 Fumarate reductase respiratory complex transmembrane subunits                         CATH domains
               Pfam domains CybS-1zoyD01 D:35-135                                                                                - Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------ Transcript
                 1zoy D  35 SSKAASLHWTGERVVSVLLLGLLPAAYLNPCSAMDYSLAAALTLHGHWGIGQVVTDYVRGDALQKAAKAGLLALSAFTFAGLCYFNYHDVGICKAVAMLWKL 136
                                    44        54        64        74        84        94       104       114       124       134

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric/Biological Unit

Clans(

)

Families(

)

Organisms( (-)

)

Clan: FumRed-TM (17)

Family: CybS (3)

Sus scrofa (Pig) (1)

CybS-1zoyD01

D:35-135

Family: Sdh_cyt (10)

Sus scrofa (Pig) (1)

Sdh_cyt-1zoyC01

C:21-140

Asymmetric/Biological Unit(hide GO term definitions)

Chain A (SDHA_PIG | Q0QF01)

molecular function
	GO:0050660	flavin adenine dinucleotide binding	Interacting selectively and non-covalently with FAD, flavin-adenine dinucleotide, the coenzyme or the prosthetic group of various flavoprotein oxidoreductase enzymes, in either the oxidized form, FAD, or the reduced form, FADH2.
	GO:0016491	oxidoreductase activity	Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
	GO:0016627	oxidoreductase activity, acting on the CH-CH group of donors	Catalysis of an oxidation-reduction (redox) reaction in which a CH-CH group acts as a hydrogen or electron donor and reduces a hydrogen or electron acceptor.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0008177	succinate dehydrogenase (ubiquinone) activity	Catalysis of the reaction: succinate + ubiquinone = fumarate + ubiquinol.
biological process
	GO:0022900	electron transport chain	A process in which a series of electron carriers operate together to transfer electrons from donors to any of several different terminal electron acceptors to generate a transmembrane electrochemical gradient.
	GO:0055114	oxidation-reduction process	A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
	GO:0022904	respiratory electron transport chain	A process in which a series of electron carriers operate together to transfer electrons from donors such as NADH and FADH2 to any of several different terminal electron acceptors to generate a transmembrane electrochemical gradient.
	GO:0006099	tricarboxylic acid cycle	A nearly universal metabolic pathway in which the acetyl group of acetyl coenzyme A is effectively oxidized to two CO2 and four pairs of electrons are transferred to coenzymes. The acetyl group combines with oxaloacetate to form citrate, which undergoes successive transformations to isocitrate, 2-oxoglutarate, succinyl-CoA, succinate, fumarate, malate, and oxaloacetate again, thus completing the cycle. In eukaryotes the tricarboxylic acid is confined to the mitochondria. See also glyoxylate cycle.
cellular component
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005743	mitochondrial inner membrane	The inner, i.e. lumen-facing, lipid bilayer of the mitochondrial envelope. It is highly folded to form cristae.
	GO:0005749	mitochondrial respiratory chain complex II, succinate dehydrogenase complex (ubiquinone)	A protein complex located in the mitochondrial inner membrane that forms part of the mitochondrial respiratory chain. Contains the four polypeptide subunits of succinate dehydrogenase, flavin-adenine dinucleotide and iron-sulfur. Catalyzes the oxidation of succinate by ubiquinone. Connects the TCA cycle with the respiratory chain.
	GO:0005739	mitochondrion	A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.

Chain B (SDHB_PIG | Q007T0)

molecular function
	GO:0051537	2 iron, 2 sulfur cluster binding	Interacting selectively and non-covalently with a 2 iron, 2 sulfur (2Fe-2S) cluster; this cluster consists of two iron atoms, with two inorganic sulfur atoms found between the irons and acting as bridging ligands.
	GO:0051538	3 iron, 4 sulfur cluster binding	Interacting selectively and non-covalently with a 3 iron, 4 sulfur (3Fe-4S) cluster; this cluster consists of three iron atoms, with the inorganic sulfur atoms found between the irons and acting as bridging ligands. It is essentially a 4Fe-4S cluster with one iron missing.
	GO:0051539	4 iron, 4 sulfur cluster binding	Interacting selectively and non-covalently with a 4 iron, 4 sulfur (4Fe-4S) cluster; this cluster consists of four iron atoms, with the inorganic sulfur atoms found between the irons and acting as bridging ligands.
	GO:0009055	electron carrier activity	Any molecular entity that serves as an electron acceptor and electron donor in an electron transport chain. An electron transport chain is a process in which a series of electron carriers operate together to transfer electrons from donors to any of several different terminal electron acceptors to generate a transmembrane electrochemical gradient.
	GO:0051536	iron-sulfur cluster binding	Interacting selectively and non-covalently with an iron-sulfur cluster, a combination of iron and sulfur atoms.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0016491	oxidoreductase activity	Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0008177	succinate dehydrogenase (ubiquinone) activity	Catalysis of the reaction: succinate + ubiquinone = fumarate + ubiquinol.
	GO:0048039	ubiquinone binding	Interacting selectively and non-covalently with ubiquinone, a quinone derivative with a tail of isoprene units.
biological process
	GO:0055114	oxidation-reduction process	A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
	GO:0006099	tricarboxylic acid cycle	A nearly universal metabolic pathway in which the acetyl group of acetyl coenzyme A is effectively oxidized to two CO2 and four pairs of electrons are transferred to coenzymes. The acetyl group combines with oxaloacetate to form citrate, which undergoes successive transformations to isocitrate, 2-oxoglutarate, succinyl-CoA, succinate, fumarate, malate, and oxaloacetate again, thus completing the cycle. In eukaryotes the tricarboxylic acid is confined to the mitochondria. See also glyoxylate cycle.
cellular component
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005743	mitochondrial inner membrane	The inner, i.e. lumen-facing, lipid bilayer of the mitochondrial envelope. It is highly folded to form cristae.
	GO:0005749	mitochondrial respiratory chain complex II, succinate dehydrogenase complex (ubiquinone)	A protein complex located in the mitochondrial inner membrane that forms part of the mitochondrial respiratory chain. Contains the four polypeptide subunits of succinate dehydrogenase, flavin-adenine dinucleotide and iron-sulfur. Catalyzes the oxidation of succinate by ubiquinone. Connects the TCA cycle with the respiratory chain.
	GO:0005739	mitochondrion	A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.

Chain C (C560_PIG | D0VWV4)

molecular function
	GO:0009055	electron carrier activity	Any molecular entity that serves as an electron acceptor and electron donor in an electron transport chain. An electron transport chain is a process in which a series of electron carriers operate together to transfer electrons from donors to any of several different terminal electron acceptors to generate a transmembrane electrochemical gradient.
	GO:0020037	heme binding	Interacting selectively and non-covalently with heme, any compound of iron complexed in a porphyrin (tetrapyrrole) ring.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0016627	oxidoreductase activity, acting on the CH-CH group of donors	Catalysis of an oxidation-reduction (redox) reaction in which a CH-CH group acts as a hydrogen or electron donor and reduces a hydrogen or electron acceptor.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0000104	succinate dehydrogenase activity	Catalysis of the reaction: succinate + acceptor = fumarate + reduced acceptor.
biological process
	GO:0006121	mitochondrial electron transport, succinate to ubiquinone	The transfer of electrons from succinate to ubiquinone that occurs during oxidative phosphorylation, mediated by the multisubunit enzyme known as complex II.
	GO:0055114	oxidation-reduction process	A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
	GO:0006099	tricarboxylic acid cycle	A nearly universal metabolic pathway in which the acetyl group of acetyl coenzyme A is effectively oxidized to two CO2 and four pairs of electrons are transferred to coenzymes. The acetyl group combines with oxaloacetate to form citrate, which undergoes successive transformations to isocitrate, 2-oxoglutarate, succinyl-CoA, succinate, fumarate, malate, and oxaloacetate again, thus completing the cycle. In eukaryotes the tricarboxylic acid is confined to the mitochondria. See also glyoxylate cycle.
cellular component
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005743	mitochondrial inner membrane	The inner, i.e. lumen-facing, lipid bilayer of the mitochondrial envelope. It is highly folded to form cristae.
	GO:0005749	mitochondrial respiratory chain complex II, succinate dehydrogenase complex (ubiquinone)	A protein complex located in the mitochondrial inner membrane that forms part of the mitochondrial respiratory chain. Contains the four polypeptide subunits of succinate dehydrogenase, flavin-adenine dinucleotide and iron-sulfur. Catalyzes the oxidation of succinate by ubiquinone. Connects the TCA cycle with the respiratory chain.
	GO:0005739	mitochondrion	A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.
	GO:0045281	succinate dehydrogenase complex	A multimeric complex which consists of flavoprotein (subunit A ; InterPro:IPR003952), iron-sulfur protein (subunit B) and membrane-bound cytochrome b560 (subunit C; InterPro:IPR000701). In some Archaea, the membrane-bound subunits (C or C and D) do not necessarily contain heme. Membrane-bound subunits can bind or react with quinones.

Chain D (DHSD_PIG | A5GZW8)

molecular function
	GO:0020037	heme binding	Interacting selectively and non-covalently with heme, any compound of iron complexed in a porphyrin (tetrapyrrole) ring.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0000104	succinate dehydrogenase activity	Catalysis of the reaction: succinate + acceptor = fumarate + reduced acceptor.
	GO:0048039	ubiquinone binding	Interacting selectively and non-covalently with ubiquinone, a quinone derivative with a tail of isoprene units.
biological process
	GO:0055114	oxidation-reduction process	A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
	GO:0006099	tricarboxylic acid cycle	A nearly universal metabolic pathway in which the acetyl group of acetyl coenzyme A is effectively oxidized to two CO2 and four pairs of electrons are transferred to coenzymes. The acetyl group combines with oxaloacetate to form citrate, which undergoes successive transformations to isocitrate, 2-oxoglutarate, succinyl-CoA, succinate, fumarate, malate, and oxaloacetate again, thus completing the cycle. In eukaryotes the tricarboxylic acid is confined to the mitochondria. See also glyoxylate cycle.
cellular component
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005740	mitochondrial envelope	The double lipid bilayer enclosing the mitochondrion and separating its contents from the cell cytoplasm; includes the intermembrane space.
	GO:0005743	mitochondrial inner membrane	The inner, i.e. lumen-facing, lipid bilayer of the mitochondrial envelope. It is highly folded to form cristae.
	GO:0005749	mitochondrial respiratory chain complex II, succinate dehydrogenase complex (ubiquinone)	A protein complex located in the mitochondrial inner membrane that forms part of the mitochondrial respiratory chain. Contains the four polypeptide subunits of succinate dehydrogenase, flavin-adenine dinucleotide and iron-sulfur. Catalyzes the oxidation of succinate by ubiquinone. Connects the TCA cycle with the respiratory chain.
	GO:0005739	mitochondrion	A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		EPH	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		F3S	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		FAD	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		FES	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		HEM	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		SF4	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		UQ1	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]
		AC6	[ RasMol ]	+environment [ RasMol ]
		AC7	[ RasMol ]	+environment [ RasMol ]
		AC8	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1zoy)

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym./Biol. Unit PNG format \| Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1zoy
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	C560_PIG \| D0VWV4
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	DHSD_PIG \| A5GZW8
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	SDHA_PIG \| Q0QF01
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	SDHB_PIG \| Q007T0
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	1.3.5.1
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	C560_PIG \| D0VWV4
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	DHSD_PIG \| A5GZW8
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	SDHA_PIG \| Q0QF01
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	SDHB_PIG \| Q007T0
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

1zp0	MITOCHONDRIAL RESPIRATORY COMPLEX II BOUND WITH 3- NITROPROPIONATE AND 2-THENOYLTRIFLUOROACETONE

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (7, 8)

Sites (8, 8)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (7, 7)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (7, 7)

CATH Domains (8, 9)

Pfam Domains (2, 2)

Gene Ontology (26, 57)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File