|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 1ZHV) |
Sites (0, 0)| (no "Site" information available for 1ZHV) |
SS Bonds (0, 0)| (no "SS Bond" information available for 1ZHV) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1ZHV) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1ZHV) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1ZHV) |
Exons (0, 0)| (no "Exon" information available for 1ZHV) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:134 aligned with A9CJY8_AGRFC | A9CJY8 from UniProtKB/TrEMBL Length:127 Alignment length:134 127 11 21 31 41 51 61 71 81 91 101 111 121 | - A9CJY8_AGRFC 2 APRIKLKILNGSYGIARLSASEAIPAWADGGGFVSITRTDDELSIVCLIDRIPQDVRVDPGWSCFKFQGPFAFDETGIVLSVISPLSTNGIGIFVVSTFDGDHLLVRSNDLEKTADLLANAGHSLL-------- - SCOP domains d1zhva1 A:2-61 Hypothetical protein Atu0741 d1zhva2 A:62-127 Hypothetical protein Atu0741 -------- SCOP domains CATH domains -------------------------------------------------------------------------------------------------------------------------------------- CATH domains Pfam domains -------------------------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE -------------------------------------------------------------------------------------------------------------------------------------- PROSITE Transcript -------------------------------------------------------------------------------------------------------------------------------------- Transcript 1zhv A 2 APRIKLKILNGSYGIARLSASEAIPAWADGGGFVSITRTDDELSIVCLIDRIPQDVRVDPGWSCFKFQGPFAFDETGIVLSVISPLSTNGIGIFVVSTFDGDHLLVRSNDLEKTADLLANAGHSLLLEHHHHHH 135 11 21 31 41 51 61 71 81 91 101 111 121 131
|
||||||||||||||||||||
SCOP Domains (1, 2)
Asymmetric Unit
|
CATH Domains (0, 0)| (no "CATH Domain" information available for 1ZHV) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 1ZHV) |
Gene Ontology (0, 0)|
Asymmetric Unit(hide GO term definitions)
(no "Gene Ontology" information available for 1ZHV)
|
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|