|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric/Biological Unit (1, 3)
|
Asymmetric Unit (3, 3)
|
Asymmetric/Biological Unit
|
Asymmetric/Biological Unit
|
(no "SAP(SNP)/Variant" information available for 1ZGX) |
(no "PROSITE Motif" information available for 1ZGX) |
(no "Exon" information available for 1ZGX) |
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:63 aligned with RNSA_STRAU | P05798 from UniProtKB/Swiss-Prot Length:96 Alignment length:63 10 20 30 40 50 60 RNSA_STRAU 1 DVSGTVCLSALPPEATDTLNLIASDGPFPYSQDGVVFQNRESVLPTQSYGYYHEYTVITPGAR 63 SCOP domains --------------------------------------------------------------- SCOP domains CATH domains --------------------------------------------------------------- CATH domains Pfam domains --------------------------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------------------- SAPs(SNPs) PROSITE --------------------------------------------------------------- PROSITE Transcript --------------------------------------------------------------- Transcript 1zgx A 1 DVSGTVCLSALPPEATDTLNLIASDGPFPYSQDGVVFQNRESVLPTQSYGYYHEYTVITPGAR 63 10 20 30 40 50 60 Chain B from PDB Type:PROTEIN Length:33 aligned with RNSA_STRAU | P05798 from UniProtKB/Swiss-Prot Length:96 Alignment length:33 73 83 93 RNSA_STRAU 64 TRGTRRIITGEATQEDYYTGDHYATFSLIDQTC 96 SCOP domains --------------------------------- SCOP domains CATH domains --------------------------------- CATH domains Pfam domains (1) Ribonuclease-1zgxB01 B:64-92 ---- Pfam domains (1) Pfam domains (2) Ribonuclease-1zgxB02 B:64-92 ---- Pfam domains (2) SAPs(SNPs) --------------------------------- SAPs(SNPs) PROSITE --------------------------------- PROSITE Transcript --------------------------------- Transcript 1zgx B 64 TRGTRRIITGEATQEDYYTGDHYATFSLIDKTC 96 73 83 93
|
(no "SCOP Domain" information available for 1ZGX) |
(no "CATH Domain" information available for 1ZGX) |
Asymmetric/Biological Unit
|
Asymmetric/Biological Unit(hide GO term definitions) Chain A,B (RNSA_STRAU | P05798)
|
|
|
|
|
|
|