|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 7)
Asymmetric/Biological Unit (1, 7)
|
Sites (0, 0)| (no "Site" information available for 1ZCE) |
SS Bonds (0, 0)| (no "SS Bond" information available for 1ZCE) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1ZCE) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1ZCE) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1ZCE) |
Exons (0, 0)| (no "Exon" information available for 1ZCE) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:146 aligned with A9CHJ4_AGRFC | A9CHJ4 from UniProtKB/TrEMBL Length:147 Alignment length:146 11 21 31 41 51 61 71 81 91 101 111 121 131 141 A9CHJ4_AGRFC 2 ANYWLYKSEPFKWSWEMQKAKGETGEEWTGVRNYQARNNMRAMKIGDKGFFYHSNEGLDVVGIVEVCALSHPDSTAEGDLKWDCVDIRAVCDMPQPVSLKDVKANPKLEKMSLVTSMRLSVQPVTEEEYLEVCRMGGLANPPKSPD 147 SCOP domains d1zcea1 A:2-147 Hypothetical protein Atu2648 SCOP domains CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE Transcript -------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 1zce A 2 ANYWLYKSEPFKWSWEmQKAKGETGEEWTGVRNYQARNNmRAmKIGDKGFFYHSNEGLDVVGIVEVCALSHPDSTAEGDLKWDCVDIRAVCDmPQPVSLKDVKANPKLEKmSLVTSmRLSVQPVTEEEYLEVCRmGGLANPPKSPD 147 11 | 21 31 41 | 51 61 71 81 91 | 101 111| |121 131 | 141 18-MSE 41-MSE 94-MSE 112-MSE | 136-MSE 44-MSE 118-MSE
|
||||||||||||||||||||
SCOP Domains (1, 1)
Asymmetric/Biological Unit
|
CATH Domains (0, 0)| (no "CATH Domain" information available for 1ZCE) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 1ZCE) |
Gene Ontology (0, 0)|
Asymmetric/Biological Unit(hide GO term definitions)
(no "Gene Ontology" information available for 1ZCE)
|
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|