Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit - manually
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit - manually
Asym./Biol. Unit - manually  (Jmol Viewer)
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  X-RAY CRYSTAL STRUCTURE OF PROTEIN AF1704 FROM ARCHAEOGLOBUS FULGIDUS. NORTHEAST STRUCTURAL GENOMICS CONSORTIUM TARGET GR62A.
 
Authors :  F. Forouhar, M. Abashidze, K. Conover, T. B. Acton, G. T. Montelione, J. L. Tong, Northeast Structural Genomics Consortium (Nesg)
Date :  08 Apr 05  (Deposition) - 19 Apr 05  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.30
Chains :  Asym./Biol. Unit :  A
Keywords :  Alpha-Beta Protein, Structural Genomics, Psi, Protein Structure Initiative, Northeast Structural Genomics Consortium, Nesg, Unknown Function (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  

PubMed: search

(-) Compounds

Molecule 1 - HYPOTHETICAL PROTEIN AF1704
    ChainsA
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidBL21
    Expression System StrainBL21(DE3)+MAGIC
    Expression System Taxid562
    Expression System Vector TypePET15
    Organism ScientificARCHAEOGLOBUS FULGIDUS
    Organism Taxid224325
    StrainDSM 4304

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 9)

Asymmetric/Biological Unit (1, 9)
No.NameCountTypeFull Name
1MSE9Mod. Amino AcidSELENOMETHIONINE

(-) Sites  (0, 0)

(no "Site" information available for 1ZBM)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1ZBM)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1ZBM)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1ZBM)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1ZBM)

(-) Exons   (0, 0)

(no "Exon" information available for 1ZBM)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:264
 aligned with O28569_ARCFU | O28569 from UniProtKB/TrEMBL  Length:271

    Alignment length:264
                               1                                                                                                                                                                                                                                                                    
                               |     7        17        27        37        47        57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207       217       227       237       247       257    
         O28569_ARCFU     - ---MKIRVAHTPDADDAFMFYAMTHGKVDTWLEIEHVIEDIETLNRKAFNAEYEVTAISAHAYALLDDKYRILSAGASVGDGYGPVVVAKSEISLDGKRIAVPGRYTTANLLLKLAVEDFEPVEMPFDRIIQAVLDEEVDAGLLIHEGQITYADYGLKCVLDLWDWWSEQVKLPLPLGLNAIRRDLSVEVQEEFLRAMRESIAFAIENPDEAIEYAMKYSRGLDRERAKRFAMMYVNDYTYNMPESVDAALKKLYEMAEAKGLI 261
               SCOP domains ----d1zbma1 A:2-261 Hypothetical protein AF1704                                                                                                                                                                                                                          SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains -----VitK2_biosynth-1zbmA01 A:3-257                                                                                                                                                                                                                                 ---- Pfam domains
         Sec.struct. author ....eeeeee..hhhhhhhhhhhhh.......eeeeee.hhhhhhhhhhhh...eeeeehhhhh.....eee.....eee.....eeee.........eeee....hhhhhhhhhhh...eeee.hhhhhhhhhhh....eeee.hhhhhhhhhhh.eeeeehhhhhhh.....eeeeeeeee...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 1zbm A  -2 HHSHKIRVAHTPDADDAFmFYAmTHGKVDTWLEIEHVIEDIETLNRKAFNAEYEVTAISAHAYALLDDKYRILSAGASVGDGYGPVVVAKSEISLDGKRIAVPGRYTTANLLLKLAVEDFEPVEmPFDRIIQAVLDEEVDAGLLIHEGQITYADYGLKCVLDLWDWWSEQVKLPLPLGLNAIRRDLSVEVQEEFLRAmRESIAFAIENPDEAIEYAmKYSRGLDRERAKRFAmmYVNDYTYNmPESVDAALKKLYEmAEAKGLI 261
                                     7        17  |     27        37        47        57        67        77        87        97       107       117    |  127       137       147       157       167       177       187       197       207      |217       227  ||   237  |    247      |257    
                                             16-MSE                                                                                                   122-MSE                                                                  195-MSE            214-MSE         230-MSE   240-MSE       254-MSE   
                                                 20-MSE                                                                                                                                                                                                            231-MSE                          

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

Asymmetric/Biological Unit

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 1ZBM)

(-) Pfam Domains  (1, 1)

Asymmetric/Biological Unit
(-)
Clan: PBP (391)

(-) Gene Ontology  (3, 3)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A   (O28569_ARCFU | O28569)
molecular function
    GO:0016830    carbon-carbon lyase activity    Catalysis of the cleavage of C-C bonds by other means than by hydrolysis or oxidation, or conversely adding a group to a double bond.
    GO:0016829    lyase activity    Catalysis of the cleavage of C-C, C-O, C-N and other bonds by other means than by hydrolysis or oxidation, or conversely adding a group to a double bond. They differ from other enzymes in that two substrates are involved in one reaction direction, but only one in the other direction. When acting on the single substrate, a molecule is eliminated and this generates either a new double bond or a new ring.
biological process
    GO:0009234    menaquinone biosynthetic process    The chemical reactions and pathways resulting in the formation of any of the menaquinones. Structurally, menaquinones consist of a methylated naphthoquinone ring structure and side chains composed of a variable number of unsaturated isoprenoid residues. Menaquinones that have vitamin K activity and are known as vitamin K2.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    MSE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
(no "Sites" information available for 1zbm)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1zbm)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1zbm
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  O28569_ARCFU | O28569
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  O28569_ARCFU | O28569
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1ZBM)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1ZBM)