Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  NMR SOLUTION STRUCTURE OF A LEAF-SPECIFIC-EXPRESSED CYCLOTIDE VHL-1
 
Authors :  B. Chen, M. L. Colgrave, N. L. Daly, K. J. Rosengren, K. R. Gustafson, D. J. Craik
Date :  05 Apr 05  (Deposition) - 12 Apr 05  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (20x)
Keywords :  Circular Protein, Cyclic Cystine Knot Motif, Antiviral Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  B. Chen, M. L. Colgrave, N. L. Daly, K. J. Rosengren, K. R. Gustafson, D. J. Craik
Isolation And Characterization Of Novel Cyclotides From Viola Hederaceae: Solution Structure And Anti-Hiv Activity Of Vhl-1, A Leaf-Specific Expressed Cyclotide.
J. Biol. Chem. V. 280 22395 2005
PubMed-ID: 15824119  |  Reference-DOI: 10.1074/JBC.M501737200
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - VHL-1
    Chains: A
    Organism Scientific: VIOLA HEDERACEA
    Organism Taxid: 180952

 Structural Features

(-) Chains, Units

  
NMR Structure (20x): 

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1ZA8)

(-) Sites  (0, 0)

(no "Site" information available for 1ZA8)

(-) SS Bonds  (3, 3)

NMR Structure
No.Residues
1A:1 -A:18
2A:5 -A:20
3A:11 -A:25

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1ZA8)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1ZA8)

(-) PROSITE Motifs  (1, 1)

NMR Structure (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1CYCLOTIDE_BRACELETPS60008 Cyclotides bracelet subfamily signature.VHL1_VIOHE4-14  1A:1-11

(-) Exons   (0, 0)

(no "Exon" information available for 1ZA8)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:31
 aligned with VHL1_VIOHE | P84522 from UniProtKB/Swiss-Prot  Length:31

    Alignment length:31
                                                      31   
                                    13        23       | - 
            VHL1_VIOHE    4 CGESCAMISFCFTEVIGCSCKNKVCYLN---  -
               SCOP domains ------------------------------- SCOP domains
               CATH domains ------------------------------- CATH domains
               Pfam domains Cyclotide-1za8A01 A:1-28    --- Pfam domains
         Sec.struct. author ..ee......hhhhh...eee..eee..... Sec.struct. author
                 SAPs(SNPs) ------------------------------- SAPs(SNPs)
                    PROSITE CYCLOTIDE_B-------------------- PROSITE
                 Transcript ------------------------------- Transcript
                  1za8 A  1 CGESCAMISFCFTEVIGCSCKNKVCYLNSIS 31
                                    10        20        30
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 1ZA8)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 1ZA8)

(-) Pfam Domains  (1, 1)

NMR Structure
(-)
Clan: no clan defined [family: Cyclotide] (21)

(-) Gene Ontology  (2, 2)

NMR Structure(hide GO term definitions)
Chain A   (VHL1_VIOHE | P84522)
biological process
    GO:0006952    defense response    Reactions, triggered in response to the presence of a foreign body or the occurrence of an injury, which result in restriction of damage to the organism attacked or prevention/recovery from the infection caused by the attack.
    GO:0051607    defense response to virus    Reactions triggered in response to the presence of a virus that act to protect the cell or organism.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1za8)
 
  Sites
(no "Sites" information available for 1za8)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1za8)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ NMR Structure - model 1 PNG format | NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1za8
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  VHL1_VIOHE | P84522
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  VHL1_VIOHE | P84522
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1ZA8)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1ZA8)