1Z9F - JenaLib

Title :   CRYSTAL STRUCTURE OF SINGLE STRANDED DNA-BINDING PROTEIN (TM0604) FROM THERMOTOGA MARITIMA AT 2.60 A RESOLUTION

Authors :   Joint Center For Structural Genomics (Jcsg)

Date :   01 Apr 05 (Deposition) - 12 Apr 05 (Release) - 13 Jul 11 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.30

Chains :   Asym. Unit : A
Biol. Unit 1: A  (2x)
Biol. Unit 2: A  (4x)

Keywords :   Tm0604, Single Stranded Dna-Binding Protein, Structural Genomics, Joint Center For Structural Genomics, Jcsg, Protein Structure Initiative, Psi, Dna Binding Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   M. Didonato, S. S. Krishna, R. Schwarzenbacher, D. Mcmullan, L. Jaroszewski, M. D. Miller, P. Abdubek, S. Agarwalla, E. Ambing, H. Axelrod, T. Biorac, H. J. Chiu, A. M. Deacon, M. A. Elsliger, J. Feuerhelm, A. Godzik, C. Grittini, S. K. Grzechnik, J. Hale, E. Hampton, J. Haugen, M. Hornsby, H. E. Klock, M. W. Knuth, E. Koesema, A. Kreusch, P. Kuhn, S. A. Lesley, K. Moy, E. Nigoghossian, L. Okach, J. Paulsen, K. Quijano, R. Reyes, C. Rife, G. Spraggon, R. C. Stevens, H. Van Den Bedem, J. Velasquez, A. White, G. Wolf, Q. Xu, K. O. Hodgson J. Wooley, I. A. Wilson
Crystal Structure Of A Single-Stranded Dna-Binding Protein (Tm0604) From Thermotoga Maritima At 2. 60 A Resolution.
Proteins V. 63 256 2006
PubMed-ID: 16435371 | Reference-DOI: 10.1002/PROT.20841

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (1, 1)

Asymmetric Unit (1, 1)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	SSB	PS50935	Single-strand binding (SSB) domain profile.	SSB_THEMA	4-108	1	A:4-108

Biological Unit 1 (1, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	SSB	PS50935	Single-strand binding (SSB) domain profile.	SSB_THEMA	4-108	2	A:4-108

Biological Unit 2 (1, 4)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	SSB	PS50935	Single-strand binding (SSB) domain profile.	SSB_THEMA	4-108	4	A:4-108

Exons (0, 0)

Sequences/Alignments

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:89
 aligned with SSB_THEMA | Q9WZ73 from UniProtKB/Swiss-Prot  Length:141

    Alignment length:109
                             1                                                                                                           
                             |       9        19        29        39        49        59        69        79        89        99         
            SSB_THEMA     - -MSFFNKIILIGRLVRDPEERYTLSGTPVTTFTIAVDRVPRKNAPDDAQTTDFFRIVTFGRLAEFARTYLTKGRLVLVEGEMRMRRWETPTGEKRVSPEVVANVVRFMD 108
               SCOP domains d1z9fa_ A: automated mat  ches                                                                                SCOP domains
               CATH domains 1z9fA00 A:0-108 Nucleic   acid-binding            proteins                                                    CATH domains
               Pfam domains ----SSB-1z9fA01 A:4-107                                                                                     - Pfam domains
         Sec.struct. author .......eeeeeee....eeee..--.eeeeeeeee..-----------..eeeeeeeehhhhhhhhhhh....eeeeeeeeeee.-------...eeeeeeeeeee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----SSB  PDB: A:4-108 UniProt: 4-108                                                                          PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------- Transcript
                 1z9f A   0 HMSFFNKIILIGRLVRDPEERYTL--TPVTTFTIAVDR-----------TTDFFRIVTFGRLAEFARTYLTKGRLVLVEGEMRMRR-------KRVSPEVVANVVRFMD 108
                                     9        19   |  | 29       | -        49        59        69        79     |   -   |    99         
                                                  23 26         37          49                                  85      93

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (1, 1)

CATH Domains (1, 1)

Pfam Domains (1, 1)

Gene Ontology (3, 3)

Asymmetric Unit(hide GO term definitions)

Chain A (SSB_THEMA | Q9WZ73)

molecular function
	GO:0003677	DNA binding	Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
	GO:0003697	single-stranded DNA binding	Interacting selectively and non-covalently with single-stranded DNA.
biological process
	GO:0006260	DNA replication	The cellular metabolic process in which a cell duplicates one or more molecules of DNA. DNA replication begins when specific sequences, known as origins of replication, are recognized and bound by initiation proteins, and ends when the original DNA molecule has been completely duplicated and the copies topologically separated. The unit of replication usually corresponds to the genome of the cell, an organelle, or a virus. The template for replication can either be an existing DNA molecule or RNA.

Visualization

Interactive Views

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1z9f)

	Sites
(no "Sites" information available for 1z9f)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1z9f)

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]

Still Images

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	1z9f
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	SSB_THEMA \| Q9WZ73
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Analysis Tools

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	SSB_THEMA \| Q9WZ73
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

Description