1Z8K - JenaLib

Asym./Biol. Unit (Jmol Viewer)

Title :   X-RAY STRUCTURE OF ALLENE OXIDE CYCLASE FROM ARABIDOPSIS THALIANA AT3G25770

Authors :   G. E. Wesenberg, G. N. Phillips Jr. , E. Bitto, C. A. Bingman, S. T. M. All Center For Eukaryotic Structural Genomics (Cesg)

Date :   30 Mar 05 (Deposition) - 12 Apr 05 (Release) - 13 Jul 11 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.71

Chains :   Asym./Biol. Unit : A,B,C

Keywords :   Structural Genomics, Protein Structure Initiative, Psi, Cesg, At3G25770, Center For Eukaryotic Structural Genomics, Jasmonic Acid Biosynthesis, Plant Protein, Isomerase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   Center For Eukaryotic Structural Genomics (Cesg)
X-Ray Structure Of Allene Oxide Cyclase From Arabidopsis Thaliana At3G25770
To Be Published
PubMed: search

Molecule 1 - AT3G25770 PROTEIN
	Chains	:	A, B, C
	EC Number	:	5.3.99.6
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PVP-27
	Expression System Strain	:	B834 P(RARE2)
	Expression System Taxid	:	562
	Expression System Vector Type	:	PLASMID
	Gene	:	AT3G25770
	Organism Common	:	THALE CRESS
	Organism Scientific	:	ARABIDOPSIS THALIANA
	Organism Taxid	:	3702

		1	2	3
Asymmetric/Biological Unit	:	A	B	C

Summary Information (see also Sequences/Alignments below)

Asymmetric/Biological Unit (1, 3)

No.	Name	Count	Type	Full Name
1	MSE	3	Mod. Amino Acid	SELENOMETHIONINE

(no "Site" information available for 1Z8K)

(no "SS Bond" information available for 1Z8K)

Asymmetric/Biological Unit

No.	Residues
1	Ser A:36	-	Pro A:37
2	Tyr A:141	-	Pro A:142
3	Ser B:36	-	Pro B:37
4	Tyr B:141	-	Pro B:142
5	Ser C:36	-	Pro C:37
6	Tyr C:141	-	Pro C:142

(no "SAP(SNP)/Variant" information available for 1Z8K)

(no "PROSITE Motif" information available for 1Z8K)

(no "Exon" information available for 1Z8K)

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:174
 aligned with AOC2_ARATH | Q9LS02 from UniProtKB/Swiss-Prot  Length:253

    Alignment length:174
                                    89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249    
           AOC2_ARATH    80 KVQELSVYEINELDRHSPKILKNAFSLMFGLGDLVPFTNKLYTGDLKKRVGITAGLCVVIEHVPEKKGERFEATYSFYFGDYGHLSVQGPYLTYEDSFLAITGGAGIFEGAYGQVKLQQLVYPTKLFYTFYLKGLANDLPLELTGTPVPPSKDIEPAPEAKALEPSGVISNYTN 253
               SCOP domains d1z8ka1 A:20-193 Allene oxide cyclase, AOC                                                                                                                                     SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..eeeeeeee.......................eeee..eeee.....eeeeeeeeeeeeeeehhhheeeeeeeeeee....eeeeeeeeee....eeeeeeeeee.....eeeeeeeeee...eeeeeeeee......hhhhh............hhhhhh.hhhhh...... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 1z8k A  20 KVQELSVYEINELDRHSPKILKNAFSLmFGLGDLVPFTNKLYTGDLKKRVGITAGLCVVIEHVPEKKGERFEATYSFYFGDYGHLSVQGPYLTYEDSFLAITGGAGIFEGAYGQVKLQQLVYPTKLFYTFYLKGLANDLPLELTGTPVPPSKDIEPAPEAKALEPSGVISNYTN 193
                                    29        39       |49        59        69        79        89        99       109       119       129       139       149       159       169       179       189    
                                                      47-MSE

Chain B from PDB  Type:PROTEIN  Length:174
 aligned with AOC2_ARATH | Q9LS02 from UniProtKB/Swiss-Prot  Length:253

    Alignment length:174
                                    89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249    
           AOC2_ARATH    80 KVQELSVYEINELDRHSPKILKNAFSLMFGLGDLVPFTNKLYTGDLKKRVGITAGLCVVIEHVPEKKGERFEATYSFYFGDYGHLSVQGPYLTYEDSFLAITGGAGIFEGAYGQVKLQQLVYPTKLFYTFYLKGLANDLPLELTGTPVPPSKDIEPAPEAKALEPSGVISNYTN 253
               SCOP domains d1z8kb_ B: Allene oxide cyclase, AOC                                                                                                                                           SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..eeeeeeee.......................eeee..eeee.....eeeeeeeeeeeeeeehhhheeeeeeeeeee....eeeeeeeeee....eeeeeeeeee.....eeeeeeeeee...eeeeeeeee......hhhhh............hhhhhh.hhhhh...... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 1z8k B  20 KVQELSVYEINELDRHSPKILKNAFSLmFGLGDLVPFTNKLYTGDLKKRVGITAGLCVVIEHVPEKKGERFEATYSFYFGDYGHLSVQGPYLTYEDSFLAITGGAGIFEGAYGQVKLQQLVYPTKLFYTFYLKGLANDLPLELTGTPVPPSKDIEPAPEAKALEPSGVISNYTN 193
                                    29        39       |49        59        69        79        89        99       109       119       129       139       149       159       169       179       189    
                                                      47-MSE

Chain C from PDB  Type:PROTEIN  Length:174
 aligned with AOC2_ARATH | Q9LS02 from UniProtKB/Swiss-Prot  Length:253

    Alignment length:174
                                    89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249    
           AOC2_ARATH    80 KVQELSVYEINELDRHSPKILKNAFSLMFGLGDLVPFTNKLYTGDLKKRVGITAGLCVVIEHVPEKKGERFEATYSFYFGDYGHLSVQGPYLTYEDSFLAITGGAGIFEGAYGQVKLQQLVYPTKLFYTFYLKGLANDLPLELTGTPVPPSKDIEPAPEAKALEPSGVISNYTN 253
               SCOP domains d1z8kc_ C: Allene oxide cyclase, AOC                                                                                                                                           SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
           Pfam domains (1) Allene_ox_cyc-1z8kC01 C:20-191                                                                                                                                              -- Pfam domains (1)
           Pfam domains (2) Allene_ox_cyc-1z8kC02 C:20-191                                                                                                                                              -- Pfam domains (2)
           Pfam domains (3) Allene_ox_cyc-1z8kC03 C:20-191                                                                                                                                              -- Pfam domains (3)
         Sec.struct. author ..eeeeeeee.......................eeee..eeee.....eeeeeeeeeeeeeeehhhheeeeeeeeeee....eeeeeeeeee....eeeeeeeeee.....eeeeeeeeee...eeeeeeeee......hhhhh............hhhhhh.hhhhh...... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 1z8k C  20 KVQELSVYEINELDRHSPKILKNAFSLmFGLGDLVPFTNKLYTGDLKKRVGITAGLCVVIEHVPEKKGERFEATYSFYFGDYGHLSVQGPYLTYEDSFLAITGGAGIFEGAYGQVKLQQLVYPTKLFYTFYLKGLANDLPLELTGTPVPPSKDIEPAPEAKALEPSGVISNYTN 193
                                    29        39       |49        59        69        79        89        99       109       119       129       139       149       159       169       179       189    
                                                      47-MSE

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric/Biological Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: All beta proteins (24004)

Fold: AOC barrel-like (13)

Superfamily: Allene oxide cyclase-like (11)

Family: Allene oxide cyclase-like (9)

Protein domain: Allene oxide cyclase, AOC (6)

Thale cress (Arabidopsis thaliana), chloroplast AOC2 [TaxId: 3702] (5)

1a	d1z8ka1	A:20-193
1b	d1z8kb_	B:
1c	d1z8kc_	C:

(no "CATH Domain" information available for 1Z8K)

Asymmetric/Biological Unit

Clans(

)

Families(

)

Organisms( (-)

)

Clan: no clan defined [family: Allene_ox_cyc] (3)

Family: Allene_ox_cyc (3)

Arabidopsis thaliana (Mouse-ear cress) (3)

1a	Allene_ox_cyc-1z8kC01	C:20-191
1b	Allene_ox_cyc-1z8kC02	C:20-191
1c	Allene_ox_cyc-1z8kC03	C:20-191

Asymmetric/Biological Unit(hide GO term definitions)

Chain A,B,C (AOC2_ARATH | Q9LS02)

molecular function
	GO:0046423	allene-oxide cyclase activity	Catalysis of the reaction: (9Z,13S,15Z)-12,13-epoxyoctadeca-9,11,15-trienoate = (15Z)-12-oxophyto-10,15-dienoate.
	GO:0016853	isomerase activity	Catalysis of the geometric or structural changes within one molecule. Isomerase is the systematic name for any enzyme of EC class 5.
biological process
	GO:0009695	jasmonic acid biosynthetic process	The chemical reactions and pathways resulting in the formation of jasmonic acid, a fatty acid derivative.
	GO:0009409	response to cold	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a cold stimulus, a temperature stimulus below the optimal temperature for that organism.
cellular component
	GO:0009507	chloroplast	A chlorophyll-containing plastid with thylakoids organized into grana and frets, or stroma thylakoids, and embedded in a stroma.
	GO:0009941	chloroplast envelope	The double lipid bilayer enclosing the chloroplast and separating its contents from the rest of the cytoplasm; includes the intermembrane space.
	GO:0009570	chloroplast stroma	The space enclosed by the double membrane of a chloroplast but excluding the thylakoid space. It contains DNA, ribosomes and some temporary products of photosynthesis.
	GO:0009535	chloroplast thylakoid membrane	The pigmented membrane of a chloroplast thylakoid. An example of this component is found in Arabidopsis thaliana.
	GO:0009536	plastid	Any member of a family of organelles found in the cytoplasm of plants and some protists, which are membrane-bounded and contain DNA. Plant plastids develop from a common type, the proplastid.
	GO:0010319	stromule	Thin filamentous structure extending from the surface of all plastid types examined so far, including chloroplast, proplastid, etioplast, leucoplast, amyloplast, and chromoplast. In general, stromules are more abundant in tissues containing non-green plastids, and in cells containing smaller plastids. The primary function of stromules is still unresolved, although the presence of stromules markedly increases the plastid surface area, potentially increasing transport to and from the cytosol. Other functions of stromules, such as transfer of macromolecules between plastids and starch granule formation in cereal endosperm, may be restricted to particular tissues and cell types.

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		MSE	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
(no "Sites" information available for 1z8k)

	Cis Peptide Bonds
		Ser A:36 - Pro A:37	[ RasMol ]
		Ser B:36 - Pro B:37	[ RasMol ]
		Ser C:36 - Pro C:37	[ RasMol ]
		Tyr A:141 - Pro A:142	[ RasMol ]
		Tyr B:141 - Pro B:142	[ RasMol ]
		Tyr C:141 - Pro C:142	[ RasMol ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1z8k
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	AOC2_ARATH \| Q9LS02
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	5.3.99.6
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	AOC2_ARATH \| Q9LS02
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	AOC2_ARATH \| Q9LS02	:	2brj 2dio 2gin 2q4i 4cq6 4cq7

(no "Related Entries Specified in the PDB File" available for 1Z8K)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 3)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (6, 6)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 3)

CATH Domains (0, 0)

Pfam Domains (1, 3)

Gene Ontology (10, 10)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File